Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1499
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol CTNNB1   Gene   UCSC   Ensembl
Aliases CTNNB, MRD19, armadillo
Gene name catenin beta 1
Alternate names catenin beta-1, catenin (cadherin-associated protein), beta 1, 88kDa,
Gene location 3p22.1 (41199450: 41240447)     Exons: 17     NC_000003.12
Gene summary(Entrez) The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]
OMIM 116806

Protein Summary
Protein general information P35222  

Name: Catenin beta 1 (Beta catenin)

Length: 781  Mass: 85,497

Tissue specificity: Expressed in several hair follicle cell types

Sequence MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFT
QEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELAT
RAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHR
EGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQ
RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRT
VLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHA
PLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLS
VELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV
DGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Structural information
Interpro:  IPR011989 IPR016024 IPR000225 IPR013284
Prosite:   PS50176

Pfam:  		 PF00514

PDB:  		 1G3J 1JDH 1JPW 1LUJ 1P22 1QZ7 1T08 1TH1 2G57 2GL7 2Z6H 3DIW 3FQN 3FQR 3SL9 3SLA 3TX7 4DJS
PDBsum:   1G3J 1JDH 1JPW 1LUJ 1P22 1QZ7 1T08 1TH1 2G57 2GL7 2Z6H 3DIW 3FQN 3FQR 3SL9 3SLA 3TX7 4DJS

DIP:  		 122
MINT:   105089
STRING:   ENSP00000344456;
Other Databases GeneCards:  CTNNB1;  Malacards:  CTNNB1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological_process
GO:0000578 embryonic axis specificat
ion
 IEA biological_process
GO:0000922 spindle pole
 IEA cellular_component
GO:0001085 RNA polymerase II transcr
iption factor binding
 IPI molecular_function
GO:0001102 RNA polymerase II activat
ing transcription factor
binding
 IPI molecular_function
GO:0001569 branching involved in blo
od vessel morphogenesis
 IC biological_process
GO:0001658 branching involved in ure
teric bud morphogenesis
 IEA biological_process
GO:0001701 in utero embryonic develo
pment
 IEA biological_process
GO:0001702 gastrulation with mouth f
orming second
 IEA biological_process
GO:0001708 cell fate specification
 IEA biological_process
GO:0001711 endodermal cell fate comm
itment
 IEA biological_process
GO:0001764 neuron migration
 IEA biological_process
GO:0001837 epithelial to mesenchymal
transition
 TAS biological_process
GO:0001840 neural plate development
 IEA biological_process
GO:0001889 liver development
 IEA biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
 ISS biological_process
GO:0002053 positive regulation of me
senchymal cell proliferat
ion
 IEA biological_process
GO:0002089 lens morphogenesis in cam
era-type eye
 IEA biological_process
GO:0003266 regulation of secondary h
eart field cardioblast pr
oliferation
 IEA biological_process
GO:0003338 metanephros morphogenesis
 IEA biological_process
GO:0003340 negative regulation of me
senchymal to epithelial t
ransition involved in met
anephros morphogenesis
 IEA biological_process
GO:0003690 double-stranded DNA bindi
ng
 IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 IEA molecular_function
GO:0003713 transcription coactivator
activity
 IDA molecular_function
GO:0003713 transcription coactivator
activity
 IMP molecular_function
GO:0003713 transcription coactivator
activity
 IDA molecular_function
GO:0004871 signal transducer activit
y
 IEA molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005667 transcription factor comp
lex
 IDA cellular_component
GO:0005719 nuclear euchromatin
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005911 cell-cell junction
 IDA cellular_component
GO:0005911 cell-cell junction
 IDA cellular_component
GO:0005912 adherens junction
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005916 fascia adherens
 IEA cellular_component
GO:0005923 bicellular tight junction
 IEA cellular_component
GO:0005925 focal adhesion
 IDA cellular_component
GO:0005938 cell cortex
 IDA cellular_component
GO:0006351 transcription, DNA-templa
ted
 IEA biological_process
GO:0007155 cell adhesion
 IMP biological_process
GO:0007160 cell-matrix adhesion
 IEA biological_process
GO:0007223 Wnt signaling pathway, ca
lcium modulating pathway
 TAS biological_process
GO:0007268 chemical synaptic transmi
ssion
 IEA biological_process
GO:0007398 ectoderm development
 IEA biological_process
GO:0007403 glial cell fate determina
tion
 IEA biological_process
GO:0007494 midgut development
 IEA biological_process
GO:0008022 protein C-terminus bindin
g
 IPI molecular_function
GO:0008022 protein C-terminus bindin
g
 IPI molecular_function
GO:0008134 transcription factor bind
ing
 IPI molecular_function
GO:0008134 transcription factor bind
ing
 TAS molecular_function
GO:0008134 transcription factor bind
ing
 IPI molecular_function
GO:0008285 negative regulation of ce
ll proliferation
 IDA biological_process
GO:0009948 anterior/posterior axis s
pecification
 IEA biological_process
GO:0009950 dorsal/ventral axis speci
fication
 IEA biological_process
GO:0009954 proximal/distal pattern f
ormation
 IEA biological_process
GO:0010718 positive regulation of ep
ithelial to mesenchymal t
ransition
 IGI biological_process
GO:0010909 positive regulation of he
paran sulfate proteoglyca
n biosynthetic process
 IMP biological_process
GO:0014010 Schwann cell proliferatio
n
 IEA biological_process
GO:0014823 response to activity
 IEA biological_process
GO:0016020 membrane
 ISS cellular_component
GO:0016055 Wnt signaling pathway
 IDA biological_process
GO:0016055 Wnt signaling pathway
 TAS biological_process
GO:0016323 basolateral plasma membra
ne
 IDA cellular_component
GO:0016328 lateral plasma membrane
 IDA cellular_component
GO:0016337 single organismal cell-ce
ll adhesion
 IMP biological_process
GO:0016342 catenin complex
 IDA cellular_component
GO:0016342 catenin complex
 IDA cellular_component
GO:0016342 catenin complex
 IDA cellular_component
GO:0016600 flotillin complex
 IEA cellular_component
GO:0019827 stem cell population main
tenance
 TAS biological_process
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019900 kinase binding
 IPI molecular_function
GO:0019901 protein kinase binding
 IEA molecular_function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular_function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular_function
GO:0021819 layer formation in cerebr
al cortex
 IEA biological_process
GO:0022009 central nervous system va
sculogenesis
 IEA biological_process
GO:0030018 Z disc
 IEA cellular_component
GO:0030027 lamellipodium
 IEA cellular_component
GO:0030054 cell junction
 TAS cellular_component
GO:0030054 cell junction
 IDA cellular_component
GO:0030054 cell junction
 IDA cellular_component
GO:0030316 osteoclast differentiatio
n
 IEA biological_process
GO:0030331 estrogen receptor binding
 IPI molecular_function
GO:0030521 androgen receptor signali
ng pathway
 NAS biological_process
GO:0030539 male genitalia developmen
t
 IEA biological_process
GO:0030877 beta-catenin destruction
complex
 IDA cellular_component
GO:0030877 beta-catenin destruction
complex
 IDA cellular_component
GO:0030901 midbrain development
 IEA biological_process
GO:0030902 hindbrain development
 IEA biological_process
GO:0030997 regulation of centriole-c
entriole cohesion
 IDA biological_process
GO:0031016 pancreas development
 IEA biological_process
GO:0031069 hair follicle morphogenes
is
 IEA biological_process
GO:0031528 microvillus membrane
 IEA cellular_component
GO:0031641 regulation of myelination
 IEA biological_process
GO:0032212 positive regulation of te
lomere maintenance via te
lomerase
 IEA biological_process
GO:0032331 negative regulation of ch
ondrocyte differentiation
 IEA biological_process
GO:0032355 response to estradiol
 IDA biological_process
GO:0032403 protein complex binding
 IEA molecular_function
GO:0032481 positive regulation of ty
pe I interferon productio
n
 TAS biological_process
GO:0032993 protein-DNA complex
 IDA cellular_component
GO:0033077 T cell differentiation in
thymus
 IEA biological_process
GO:0033234 negative regulation of pr
otein sumoylation
 IDA biological_process
GO:0034097 response to cytokine
 IEA biological_process
GO:0034333 adherens junction assembl
y
 IMP biological_process
GO:0034333 adherens junction assembl
y
 IMP biological_process
GO:0034394 protein localization to c
ell surface
 IMP biological_process
GO:0034750 Scrib-APC-beta-catenin co
mplex
 IEA cellular_component
GO:0035050 embryonic heart tube deve
lopment
 IEA biological_process
GO:0035112 genitalia morphogenesis
 IEA biological_process
GO:0035115 embryonic forelimb morpho
genesis
 IEA biological_process
GO:0035116 embryonic hindlimb morpho
genesis
 IEA biological_process
GO:0035255 ionotropic glutamate rece
ptor binding
 IEA molecular_function
GO:0035257 nuclear hormone receptor
binding
 IPI molecular_function
GO:0035257 nuclear hormone receptor
binding
 TAS molecular_function
GO:0035315 hair cell differentiation
 TAS biological_process
GO:0035411 catenin import into nucle
us
 TAS biological_process
GO:0036023 embryonic skeletal limb j
oint morphogenesis
 ISS biological_process
GO:0042129 regulation of T cell prol
iferation
 IEA biological_process
GO:0042475 odontogenesis of dentin-c
ontaining tooth
 IEA biological_process
GO:0042493 response to drug
 IEP biological_process
GO:0042733 embryonic digit morphogen
esis
 IEA biological_process
GO:0043065 positive regulation of ap
optotic process
 IDA biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IEA biological_process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 TAS biological_process
GO:0043198 dendritic shaft
 IEA cellular_component
GO:0043234 protein complex
 IDA cellular_component
GO:0043410 positive regulation of MA
PK cascade
 IEA biological_process
GO:0043525 positive regulation of ne
uron apoptotic process
 IDA biological_process
GO:0044212 transcription regulatory
region DNA binding
 ISS molecular_function
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular_function
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular_function
GO:0044325 ion channel binding
 IPI molecular_function
GO:0044334 canonical Wnt signaling p
athway involved in positi
ve regulation of epitheli
al to mesenchymal transit
ion
 IMP biological_process
GO:0044336 canonical Wnt signaling p
athway involved in negati
ve regulation of apoptoti
c process
 IMP biological_process
GO:0044344 cellular response to fibr
oblast growth factor stim
ulus
 IEA biological_process
GO:0045177 apical part of cell
 IEA cellular_component
GO:0045202 synapse
 IEA cellular_component
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045445 myoblast differentiation
 IEA biological_process
GO:0045453 bone resorption
 IEA biological_process
GO:0045603 positive regulation of en
dothelial cell differenti
ation
 IEA biological_process
GO:0045669 positive regulation of os
teoblast differentiation
 IEA biological_process
GO:0045671 negative regulation of os
teoclast differentiation
 IEA biological_process
GO:0045743 positive regulation of fi
broblast growth factor re
ceptor signaling pathway
 IEA biological_process
GO:0045765 regulation of angiogenesi
s
 TAS biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 ISS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045976 negative regulation of mi
totic cell cycle, embryon
ic
 ISS biological_process
GO:0046332 SMAD binding
 IPI molecular_function
GO:0046686 response to cadmium ion
 IEA biological_process
GO:0048096 chromatin-mediated mainte
nance of transcription
 IEA biological_process
GO:0048145 regulation of fibroblast
proliferation
 TAS biological_process
GO:0048469 cell maturation
 IEA biological_process
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular_component
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular_component
GO:0048489 synaptic vesicle transpor
t
 IEA biological_process
GO:0048538 thymus development
 IEA biological_process
GO:0048599 oocyte development
 IEA biological_process
GO:0048617 embryonic foregut morphog
enesis
 IEA biological_process
GO:0048643 positive regulation of sk
eletal muscle tissue deve
lopment
 IEA biological_process
GO:0048660 regulation of smooth musc
le cell proliferation
 IMP biological_process
GO:0048701 embryonic cranial skeleto
n morphogenesis
 IEA biological_process
GO:0048715 negative regulation of ol
igodendrocyte differentia
tion
 IEA biological_process
GO:0050681 androgen receptor binding
 NAS molecular_function
GO:0050767 regulation of neurogenesi
s
 TAS biological_process
GO:0050808 synapse organization
 IEA biological_process
GO:0050998 nitric-oxide synthase bin
ding
 IEA molecular_function
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
 IMP biological_process
GO:0051145 smooth muscle cell differ
entiation
 IEA biological_process
GO:0051149 positive regulation of mu
scle cell differentiation
 TAS biological_process
GO:0051291 protein heterooligomeriza
tion
 IEA biological_process
GO:0051571 positive regulation of hi
stone H3-K4 methylation
 IC biological_process
GO:0051973 positive regulation of te
lomerase activity
 IEA biological_process
GO:0060066 oviduct development
 IEA biological_process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological_process
GO:0060440 trachea formation
 IEA biological_process
GO:0060441 epithelial tube branching
involved in lung morphog
enesis
 IEA biological_process
GO:0060479 lung cell differentiation
 IEA biological_process
GO:0060484 lung-associated mesenchym
e development
 IEA biological_process
GO:0060492 lung induction
 IEA biological_process
GO:0060742 epithelial cell different
iation involved in prosta
te gland development
 IEA biological_process
GO:0060769 positive regulation of ep
ithelial cell proliferati
on involved in prostate g
land development
 IEA biological_process
GO:0060789 hair follicle placode for
mation
 IEA biological_process
GO:0060916 mesenchymal cell prolifer
ation involved in lung de
velopment
 IEA biological_process
GO:0061154 endothelial tube morphoge
nesis
 IMP biological_process
GO:0061198 fungiform papilla formati
on
 IEA biological_process
GO:0061324 canonical Wnt signaling p
athway involved in positi
ve regulation of cardiac
outflow tract cell prolif
eration
 ISS biological_process
GO:0061549 sympathetic ganglion deve
lopment
 ISS biological_process
GO:0061550 cranial ganglion developm
ent
 IEA biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0070369 beta-catenin-TCF7L2 compl
ex
 IDA cellular_component
GO:0070369 beta-catenin-TCF7L2 compl
ex
 IDA cellular_component
GO:0070411 I-SMAD binding
 IPI molecular_function
GO:0070491 repressing transcription
factor binding
 IEA molecular_function
GO:0070602 regulation of centromeric
sister chromatid cohesio
n
 IMP biological_process
GO:0071260 cellular response to mech
anical stimulus
 IEA biological_process
GO:0071285 cellular response to lith
ium ion
 IEA biological_process
GO:0071363 cellular response to grow
th factor stimulus
 IMP biological_process
GO:0071542 dopaminergic neuron diffe
rentiation
 IEA biological_process
GO:0071681 cellular response to indo
le-3-methanol
 IDA biological_process
GO:0071944 cell periphery
 IDA cellular_component
GO:0072033 renal vesicle formation
 IEA biological_process
GO:0072053 renal inner medulla devel
opment
 IEA biological_process
GO:0072054 renal outer medulla devel
opment
 IEA biological_process
GO:0072079 nephron tubule formation
 IEA biological_process
GO:0072182 regulation of nephron tub
ule epithelial cell diffe
rentiation
 ISS biological_process
GO:0090279 regulation of calcium ion
import
 IDA biological_process
GO:1901215 negative regulation of ne
uron death
 IEA biological_process
GO:1904501 positive regulation of ch
romatin-mediated maintena
nce of transcription
 IEA biological_process
GO:1904793 regulation of euchromatin
binding
 IEA biological_process
GO:1904796 regulation of core promot
er binding
 IEA biological_process
GO:1904837 beta-catenin-TCF complex
assembly
 TAS biological_process
GO:1904886 beta-catenin destruction
complex disassembly
 TAS biological_process
GO:1990188 euchromatin binding
 IDA molecular_function
GO:1990314 cellular response to insu
lin-like growth factor st
imulus
 IEA biological_process
GO:1990403 embryonic brain developme
nt
 IEA biological_process
GO:1990791 dorsal root ganglion deve
lopment
 IEA biological_process
GO:1990907 beta-catenin-TCF complex
 IPI cellular_component
GO:1990909 Wnt signalosome
 NAS cellular_component
GO:2000008 regulation of protein loc
alization to cell surface
 IDA biological_process
GO:2000017 positive regulation of de
termination of dorsal ide
ntity
 IEA biological_process
GO:2000144 positive regulation of DN
A-templated transcription
, initiation
 IC biological_process
GO:2001234 negative regulation of ap
optotic signaling pathway
 IEA biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological_process
GO:0000578 embryonic axis specificat
ion
 IEA biological_process
GO:0000904 cell morphogenesis involv
ed in differentiation
 IEA biological_process
GO:0000922 spindle pole
 IEA cellular_component
GO:0001085 RNA polymerase II transcr
iption factor binding
 IPI molecular_function
GO:0001102 RNA polymerase II activat
ing transcription factor
binding
 IPI molecular_function
GO:0001501 skeletal system developme
nt
 IEA biological_process
GO:0001569 branching involved in blo
od vessel morphogenesis
 IEA biological_process
GO:0001569 branching involved in blo
od vessel morphogenesis
 IC biological_process
GO:0001570 vasculogenesis
 IEA biological_process
GO:0001658 branching involved in ure
teric bud morphogenesis
 IEA biological_process
GO:0001701 in utero embryonic develo
pment
 IEA biological_process
GO:0001702 gastrulation with mouth f
orming second
 IEA biological_process
GO:0001706 endoderm formation
 IEA biological_process
GO:0001708 cell fate specification
 IEA biological_process
GO:0001709 cell fate determination
 IEA biological_process
GO:0001711 endodermal cell fate comm
itment
 IEA biological_process
GO:0001764 neuron migration
 IEA biological_process
GO:0001822 kidney development
 IEA biological_process
GO:0001837 epithelial to mesenchymal
transition
 TAS biological_process
GO:0001840 neural plate development
 IEA biological_process
GO:0001889 liver development
 IEA biological_process
GO:0001944 vasculature development
 IEA biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
 IEA biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
 ISS biological_process
GO:0002053 positive regulation of me
senchymal cell proliferat
ion
 IEA biological_process
GO:0002089 lens morphogenesis in cam
era-type eye
 IEA biological_process
GO:0003266 regulation of secondary h
eart field cardioblast pr
oliferation
 IEA biological_process
GO:0003338 metanephros morphogenesis
 IEA biological_process
GO:0003340 negative regulation of me
senchymal to epithelial t
ransition involved in met
anephros morphogenesis
 IEA biological_process
GO:0003677 DNA binding
 IEA molecular_function
GO:0003682 chromatin binding
 IEA molecular_function
GO:0003690 double-stranded DNA bindi
ng
 IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 IEA molecular_function
GO:0003713 transcription coactivator
activity
 IEA molecular_function
GO:0003713 transcription coactivator
activity
 IDA molecular_function
GO:0003713 transcription coactivator
activity
 IMP molecular_function
GO:0003713 transcription coactivator
activity
 IDA molecular_function
GO:0004871 signal transducer activit
y
 IEA molecular_function
GO:0004871 signal transducer activit
y
 NAS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005667 transcription factor comp
lex
 IEA cellular_component
GO:0005667 transcription factor comp
lex
 IDA cellular_component
GO:0005719 nuclear euchromatin
 IEA cellular_component
GO:0005719 nuclear euchromatin
 IDA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005813 centrosome
 IEA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005815 microtubule organizing ce
nter
 IEA cellular_component
GO:0005829 cytosol
 IEA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005856 cytoskeleton
 IEA cellular_component
GO:0005856 cytoskeleton
 IEA cellular_component
GO:0005886 plasma membrane
 IEA cellular_component
GO:0005886 plasma membrane
 IEA cellular_component
GO:0005886 plasma membrane
 IEA cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005911 cell-cell junction
 IEA cellular_component
GO:0005911 cell-cell junction
 IDA cellular_component
GO:0005911 cell-cell junction
 IDA cellular_component
GO:0005912 adherens junction
 IEA cellular_component
GO:0005912 adherens junction
 IEA cellular_component
GO:0005912 adherens junction
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IEA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005916 fascia adherens
 IEA cellular_component
GO:0005923 bicellular tight junction
 IEA cellular_component
GO:0005925 focal adhesion
 IDA cellular_component
GO:0005938 cell cortex
 IDA cellular_component
GO:0006351 transcription, DNA-templa
ted
 IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
 IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
 IEA biological_process
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
 IEA biological_process
GO:0007155 cell adhesion
 IEA biological_process
GO:0007155 cell adhesion
 IMP biological_process
GO:0007160 cell-matrix adhesion
 IEA biological_process
GO:0007223 Wnt signaling pathway, ca
lcium modulating pathway
 TAS biological_process
GO:0007268 chemical synaptic transmi
ssion
 IEA biological_process
GO:0007398 ectoderm development
 IEA biological_process
GO:0007399 nervous system developmen
t
 IEA biological_process
GO:0007403 glial cell fate determina
tion
 IEA biological_process
GO:0007494 midgut development
 IEA biological_process
GO:0007507 heart development
 IEA biological_process
GO:0008022 protein C-terminus bindin
g
 IPI molecular_function
GO:0008022 protein C-terminus bindin
g
 IPI molecular_function
GO:0008134 transcription factor bind
ing
 IEA molecular_function
GO:0008134 transcription factor bind
ing
 IPI molecular_function
GO:0008134 transcription factor bind
ing
 TAS molecular_function
GO:0008134 transcription factor bind
ing
 IPI molecular_function
GO:0008283 cell proliferation
 IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
 IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
 IDA biological_process
GO:0009725 response to hormone
 IEA biological_process
GO:0009948 anterior/posterior axis s
pecification
 IEA biological_process
GO:0009950 dorsal/ventral axis speci
fication
 IEA biological_process
GO:0009953 dorsal/ventral pattern fo
rmation
 IEA biological_process
GO:0009954 proximal/distal pattern f
ormation
 IEA biological_process
GO:0009987 cellular process
 IEA biological_process
GO:0010468 regulation of gene expres
sion
 IEA biological_process
GO:0010628 positive regulation of ge
ne expression
 IEA biological_process
GO:0010629 negative regulation of ge
ne expression
 IEA biological_process
GO:0010718 positive regulation of ep
ithelial to mesenchymal t
ransition
 IGI biological_process
GO:0010909 positive regulation of he
paran sulfate proteoglyca
n biosynthetic process
 IMP biological_process
GO:0014010 Schwann cell proliferatio
n
 IEA biological_process
GO:0014070 response to organic cycli
c compound
 IEA biological_process
GO:0014704 intercalated disc
 IEA cellular_component
GO:0014823 response to activity
 IEA biological_process
GO:0016020 membrane
 IEA cellular_component
GO:0016020 membrane
 ISS cellular_component
GO:0016020 membrane
 IEA cellular_component
GO:0016055 Wnt signaling pathway
 IEA biological_process
GO:0016055 Wnt signaling pathway
 IEA biological_process
GO:0016055 Wnt signaling pathway
 IDA biological_process
GO:0016055 Wnt signaling pathway
 TAS biological_process
GO:0016323 basolateral plasma membra
ne
 IEA cellular_component
GO:0016323 basolateral plasma membra
ne
 IDA cellular_component
GO:0016328 lateral plasma membrane
 IEA cellular_component
GO:0016328 lateral plasma membrane
 IDA cellular_component
GO:0016331 morphogenesis of embryoni
c epithelium
 IEA biological_process
GO:0016337 single organismal cell-ce
ll adhesion
 IEA biological_process
GO:0016337 single organismal cell-ce
ll adhesion
 IMP biological_process
GO:0016342 catenin complex
 IDA cellular_component
GO:0016342 catenin complex
 IDA cellular_component
GO:0016342 catenin complex
 IDA cellular_component
GO:0016600 flotillin complex
 IEA cellular_component
GO:0019827 stem cell population main
tenance
 TAS biological_process
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019900 kinase binding
 IPI molecular_function
GO:0019901 protein kinase binding
 IEA molecular_function
GO:0019903 protein phosphatase bindi
ng
 IEA molecular_function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular_function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular_function
GO:0021819 layer formation in cerebr
al cortex
 IEA biological_process
GO:0022009 central nervous system va
sculogenesis
 IEA biological_process
GO:0022405 hair cycle process
 IEA biological_process
GO:0030018 Z disc
 IEA cellular_component
GO:0030027 lamellipodium
 IEA cellular_component
GO:0030054 cell junction
 IEA cellular_component
GO:0030054 cell junction
 IEA cellular_component
GO:0030054 cell junction
 TAS cellular_component
GO:0030054 cell junction
 IDA cellular_component
GO:0030054 cell junction
 IDA cellular_component
GO:0030097 hemopoiesis
 IEA biological_process
GO:0030154 cell differentiation
 IEA biological_process
GO:0030182 neuron differentiation
 IEA biological_process
GO:0030217 T cell differentiation
 IEA biological_process
GO:0030316 osteoclast differentiatio
n
 IEA biological_process
GO:0030324 lung development
 IEA biological_process
GO:0030331 estrogen receptor binding
 IPI molecular_function
GO:0030521 androgen receptor signali
ng pathway
 NAS biological_process
GO:0030539 male genitalia developmen
t
 IEA biological_process
GO:0030856 regulation of epithelial
cell differentiation
 IEA biological_process
GO:0030858 positive regulation of ep
ithelial cell differentia
tion
 IEA biological_process
GO:0030877 beta-catenin destruction
complex
 IEA cellular_component
GO:0030877 beta-catenin destruction
complex
 IDA cellular_component
GO:0030877 beta-catenin destruction
complex
 IDA cellular_component
GO:0030900 forebrain development
 IEA biological_process
GO:0030901 midbrain development
 IEA biological_process
GO:0030902 hindbrain development
 IEA biological_process
GO:0030997 regulation of centriole-c
entriole cohesion
 IDA biological_process
GO:0031016 pancreas development
 IEA biological_process
GO:0031069 hair follicle morphogenes
is
 IEA biological_process
GO:0031253 cell projection membrane
 IEA cellular_component
GO:0031528 microvillus membrane
 IEA cellular_component
GO:0031641 regulation of myelination
 IEA biological_process
GO:0032212 positive regulation of te
lomere maintenance via te
lomerase
 IEA biological_process
GO:0032331 negative regulation of ch
ondrocyte differentiation
 IEA biological_process
GO:0032355 response to estradiol
 IEA biological_process
GO:0032355 response to estradiol
 IDA biological_process
GO:0032403 protein complex binding
 IEA molecular_function
GO:0032481 positive regulation of ty
pe I interferon productio
n
 TAS biological_process
GO:0032993 protein-DNA complex
 IDA cellular_component
GO:0033077 T cell differentiation in
thymus
 IEA biological_process
GO:0033234 negative regulation of pr
otein sumoylation
 IDA biological_process
GO:0034097 response to cytokine
 IEA biological_process
GO:0034332 adherens junction organiz
ation
 IEA biological_process
GO:0034333 adherens junction assembl
y
 IEA biological_process
GO:0034333 adherens junction assembl
y
 IMP biological_process
GO:0034333 adherens junction assembl
y
 IMP biological_process
GO:0034394 protein localization to c
ell surface
 IMP biological_process
GO:0034613 cellular protein localiza
tion
 IEA biological_process
GO:0034750 Scrib-APC-beta-catenin co
mplex
 IEA cellular_component
GO:0035050 embryonic heart tube deve
lopment
 IEA biological_process
GO:0035112 genitalia morphogenesis
 IEA biological_process
GO:0035115 embryonic forelimb morpho
genesis
 IEA biological_process
GO:0035116 embryonic hindlimb morpho
genesis
 IEA biological_process
GO:0035255 ionotropic glutamate rece
ptor binding
 IEA molecular_function
GO:0035257 nuclear hormone receptor
binding
 IEA molecular_function
GO:0035257 nuclear hormone receptor
binding
 IPI molecular_function
GO:0035257 nuclear hormone receptor
binding
 TAS molecular_function
GO:0035315 hair cell differentiation
 TAS biological_process
GO:0035411 catenin import into nucle
us
 TAS biological_process
GO:0036023 embryonic skeletal limb j
oint morphogenesis
 IEA biological_process
GO:0036023 embryonic skeletal limb j
oint morphogenesis
 ISS biological_process
GO:0042127 regulation of cell prolif
eration
 IEA biological_process
GO:0042129 regulation of T cell prol
iferation
 IEA biological_process
GO:0042475 odontogenesis of dentin-c
ontaining tooth
 IEA biological_process
GO:0042493 response to drug
 IEP biological_process
GO:0042733 embryonic digit morphogen
esis
 IEA biological_process
GO:0042981 regulation of apoptotic p
rocess
 IEA biological_process
GO:0043005 neuron projection
 IEA cellular_component
GO:0043065 positive regulation of ap
optotic process
 IDA biological_process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
 IEA biological_process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 TAS biological_process
GO:0043198 dendritic shaft
 IEA cellular_component
GO:0043234 protein complex
 IEA cellular_component
GO:0043234 protein complex
 IDA cellular_component
GO:0043296 apical junction complex
 IEA cellular_component
GO:0043410 positive regulation of MA
PK cascade
 IEA biological_process
GO:0043525 positive regulation of ne
uron apoptotic process
 IDA biological_process
GO:0043588 skin development
 IEA biological_process
GO:0043627 response to estrogen
 IEA biological_process
GO:0044212 transcription regulatory
region DNA binding
 IEA molecular_function
GO:0044212 transcription regulatory
region DNA binding
 ISS molecular_function
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular_function
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular_function
GO:0044325 ion channel binding
 IPI molecular_function
GO:0044334 canonical Wnt signaling p
athway involved in positi
ve regulation of epitheli
al to mesenchymal transit
ion
 IMP biological_process
GO:0044336 canonical Wnt signaling p
athway involved in negati
ve regulation of apoptoti
c process
 IMP biological_process
GO:0044344 cellular response to fibr
oblast growth factor stim
ulus
 IEA biological_process
GO:0044798 nuclear transcription fac
tor complex
 IEA cellular_component
GO:0045177 apical part of cell
 IEA cellular_component
GO:0045202 synapse
 IEA cellular_component
GO:0045294 alpha-catenin binding
 IEA molecular_function
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IEA molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045445 myoblast differentiation
 IEA biological_process
GO:0045453 bone resorption
 IEA biological_process
GO:0045595 regulation of cell differ
entiation
 IEA biological_process
GO:0045596 negative regulation of ce
ll differentiation
 IEA biological_process
GO:0045603 positive regulation of en
dothelial cell differenti
ation
 IEA biological_process
GO:0045667 regulation of osteoblast
differentiation
 IEA biological_process
GO:0045669 positive regulation of os
teoblast differentiation
 IEA biological_process
GO:0045670 regulation of osteoclast
differentiation
 IEA biological_process
GO:0045671 negative regulation of os
teoclast differentiation
 IEA biological_process
GO:0045743 positive regulation of fi
broblast growth factor re
ceptor signaling pathway
 IEA biological_process
GO:0045765 regulation of angiogenesi
s
 TAS biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IEA biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IEA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 ISS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045976 negative regulation of mi
totic cell cycle, embryon
ic
 IEA biological_process
GO:0045976 negative regulation of mi
totic cell cycle, embryon
ic
 ISS biological_process
GO:0046332 SMAD binding
 IPI molecular_function
GO:0046686 response to cadmium ion
 IEA biological_process
GO:0048096 chromatin-mediated mainte
nance of transcription
 IEA biological_process
GO:0048145 regulation of fibroblast
proliferation
 TAS biological_process
GO:0048469 cell maturation
 IEA biological_process
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular_component
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular_component
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular_component
GO:0048489 synaptic vesicle transpor
t
 IEA biological_process
GO:0048513 animal organ development
 IEA biological_process
GO:0048538 thymus development
 IEA biological_process
GO:0048599 oocyte development
 IEA biological_process
GO:0048617 embryonic foregut morphog
enesis
 IEA biological_process
GO:0048643 positive regulation of sk
eletal muscle tissue deve
lopment
 IEA biological_process
GO:0048660 regulation of smooth musc
le cell proliferation
 IMP biological_process
GO:0048701 embryonic cranial skeleto
n morphogenesis
 IEA biological_process
GO:0048715 negative regulation of ol
igodendrocyte differentia
tion
 IEA biological_process
GO:0050681 androgen receptor binding
 NAS molecular_function
GO:0050767 regulation of neurogenesi
s
 TAS biological_process
GO:0050808 synapse organization
 IEA biological_process
GO:0050998 nitric-oxide synthase bin
ding
 IEA molecular_function
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
 IEA biological_process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
 IMP biological_process
GO:0051145 smooth muscle cell differ
entiation
 IEA biological_process
GO:0051149 positive regulation of mu
scle cell differentiation
 TAS biological_process
GO:0051291 protein heterooligomeriza
tion
 IEA biological_process
GO:0051571 positive regulation of hi
stone H3-K4 methylation
 IC biological_process
GO:0051973 positive regulation of te
lomerase activity
 IEA biological_process
GO:0060066 oviduct development
 IEA biological_process
GO:0060070 canonical Wnt signaling p
athway
 IEA biological_process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological_process
GO:0060173 limb development
 IEA biological_process
GO:0060439 trachea morphogenesis
 IEA biological_process
GO:0060440 trachea formation
 IEA biological_process
GO:0060441 epithelial tube branching
involved in lung morphog
enesis
 IEA biological_process
GO:0060479 lung cell differentiation
 IEA biological_process
GO:0060484 lung-associated mesenchym
e development
 IEA biological_process
GO:0060492 lung induction
 IEA biological_process
GO:0060742 epithelial cell different
iation involved in prosta
te gland development
 IEA biological_process
GO:0060769 positive regulation of ep
ithelial cell proliferati
on involved in prostate g
land development
 IEA biological_process
GO:0060789 hair follicle placode for
mation
 IEA biological_process
GO:0060916 mesenchymal cell prolifer
ation involved in lung de
velopment
 IEA biological_process
GO:0061047 positive regulation of br
anching involved in lung
morphogenesis
 IEA biological_process
GO:0061154 endothelial tube morphoge
nesis
 IMP biological_process
GO:0061198 fungiform papilla formati
on
 IEA biological_process
GO:0061324 canonical Wnt signaling p
athway involved in positi
ve regulation of cardiac
outflow tract cell prolif
eration
 IEA biological_process
GO:0061324 canonical Wnt signaling p
athway involved in positi
ve regulation of cardiac
outflow tract cell prolif
eration
 ISS biological_process
GO:0061549 sympathetic ganglion deve
lopment
 IEA biological_process
GO:0061549 sympathetic ganglion deve
lopment
 ISS biological_process
GO:0061550 cranial ganglion developm
ent
 IEA biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0070369 beta-catenin-TCF7L2 compl
ex
 IDA cellular_component
GO:0070369 beta-catenin-TCF7L2 compl
ex
 IDA cellular_component
GO:0070411 I-SMAD binding
 IPI molecular_function
GO:0070491 repressing transcription
factor binding
 IEA molecular_function
GO:0070602 regulation of centromeric
sister chromatid cohesio
n
 IEA biological_process
GO:0070602 regulation of centromeric
sister chromatid cohesio
n
 IMP biological_process
GO:0071260 cellular response to mech
anical stimulus
 IEA biological_process
GO:0071285 cellular response to lith
ium ion
 IEA biological_process
GO:0071363 cellular response to grow
th factor stimulus
 IMP biological_process
GO:0071542 dopaminergic neuron diffe
rentiation
 IEA biological_process
GO:0071664 catenin-TCF7L2 complex
 IEA cellular_component
GO:0071681 cellular response to indo
le-3-methanol
 IDA biological_process
GO:0071944 cell periphery
 IDA cellular_component
GO:0072001 renal system development
 IEA biological_process
GO:0072033 renal vesicle formation
 IEA biological_process
GO:0072053 renal inner medulla devel
opment
 IEA biological_process
GO:0072054 renal outer medulla devel
opment
 IEA biological_process
GO:0072079 nephron tubule formation
 IEA biological_process
GO:0072182 regulation of nephron tub
ule epithelial cell diffe
rentiation
 IEA biological_process
GO:0072182 regulation of nephron tub
ule epithelial cell diffe
rentiation
 ISS biological_process
GO:0090279 regulation of calcium ion
import
 IDA biological_process
GO:1901215 negative regulation of ne
uron death
 IEA biological_process
GO:1904501 positive regulation of ch
romatin-mediated maintena
nce of transcription
 IEA biological_process
GO:1904793 regulation of euchromatin
binding
 IEA biological_process
GO:1904796 regulation of core promot
er binding
 IEA biological_process
GO:1904837 beta-catenin-TCF complex
assembly
 TAS biological_process
GO:1904886 beta-catenin destruction
complex disassembly
 TAS biological_process
GO:1990188 euchromatin binding
 IEA molecular_function
GO:1990188 euchromatin binding
 IDA molecular_function
GO:1990314 cellular response to insu
lin-like growth factor st
imulus
 IEA biological_process
GO:1990403 embryonic brain developme
nt
 IEA biological_process
GO:1990791 dorsal root ganglion deve
lopment
 IEA biological_process
GO:1990907 beta-catenin-TCF complex
 IPI cellular_component
GO:1990909 Wnt signalosome
 IEA cellular_component
GO:1990909 Wnt signalosome
 NAS cellular_component
GO:2000008 regulation of protein loc
alization to cell surface
 IDA biological_process
GO:2000017 positive regulation of de
termination of dorsal ide
ntity
 IEA biological_process
GO:2000144 positive regulation of DN
A-templated transcription
, initiation
 IEA biological_process
GO:2000144 positive regulation of DN
A-templated transcription
, initiation
 IC biological_process
GO:2001234 negative regulation of ap
optotic signaling pathway
 IEA biological_process
GO:0001085 RNA polymerase II transcr
iption factor binding
 IPI molecular_function
GO:0001102 RNA polymerase II activat
ing transcription factor
binding
 IPI molecular_function
GO:0001569 branching involved in blo
od vessel morphogenesis
 IC biological_process
GO:0001837 epithelial to mesenchymal
transition
 TAS biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
 ISS biological_process
GO:0003713 transcription coactivator
activity
 IDA molecular_function
GO:0003713 transcription coactivator
activity
 IMP molecular_function
GO:0003713 transcription coactivator
activity
 IDA molecular_function
GO:0004871 signal transducer activit
y
 NAS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005667 transcription factor comp
lex
 IDA cellular_component
GO:0005719 nuclear euchromatin
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005886 plasma membrane
 IDA cellular_component
GO:0005911 cell-cell junction
 IDA cellular_component
GO:0005911 cell-cell junction
 IDA cellular_component
GO:0005912 adherens junction
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005913 cell-cell adherens juncti
on
 IDA cellular_component
GO:0005925 focal adhesion
 IDA cellular_component
GO:0005938 cell cortex
 IDA cellular_component
GO:0007155 cell adhesion
 IMP biological_process
GO:0007223 Wnt signaling pathway, ca
lcium modulating pathway
 TAS biological_process
GO:0008022 protein C-terminus bindin
g
 IPI molecular_function
GO:0008022 protein C-terminus bindin
g
 IPI molecular_function
GO:0008134 transcription factor bind
ing
 IPI molecular_function
GO:0008134 transcription factor bind
ing
 TAS molecular_function
GO:0008134 transcription factor bind
ing
 IPI molecular_function
GO:0008285 negative regulation of ce
ll proliferation
 IDA biological_process
GO:0010718 positive regulation of ep
ithelial to mesenchymal t
ransition
 IGI biological_process
GO:0010909 positive regulation of he
paran sulfate proteoglyca
n biosynthetic process
 IMP biological_process
GO:0016020 membrane
 ISS cellular_component
GO:0016055 Wnt signaling pathway
 IDA biological_process
GO:0016055 Wnt signaling pathway
 TAS biological_process
GO:0016323 basolateral plasma membra
ne
 IDA cellular_component
GO:0016328 lateral plasma membrane
 IDA cellular_component
GO:0016337 single organismal cell-ce
ll adhesion
 IMP biological_process
GO:0016342 catenin complex
 IDA cellular_component
GO:0016342 catenin complex
 IDA cellular_component
GO:0016342 catenin complex
 IDA cellular_component
GO:0019827 stem cell population main
tenance
 TAS biological_process
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019899 enzyme binding
 IPI molecular_function
GO:0019900 kinase binding
 IPI molecular_function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular_function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular_function
GO:0030054 cell junction
 TAS cellular_component
GO:0030054 cell junction
 IDA cellular_component
GO:0030054 cell junction
 IDA cellular_component
GO:0030331 estrogen receptor binding
 IPI molecular_function
GO:0030521 androgen receptor signali
ng pathway
 NAS biological_process
GO:0030877 beta-catenin destruction
complex
 IDA cellular_component
GO:0030877 beta-catenin destruction
complex
 IDA cellular_component
GO:0030997 regulation of centriole-c
entriole cohesion
 IDA biological_process
GO:0032355 response to estradiol
 IDA biological_process
GO:0032481 positive regulation of ty
pe I interferon productio
n
 TAS biological_process
GO:0032993 protein-DNA complex
 IDA cellular_component
GO:0033234 negative regulation of pr
otein sumoylation
 IDA biological_process
GO:0034333 adherens junction assembl
y
 IMP biological_process
GO:0034333 adherens junction assembl
y
 IMP biological_process
GO:0034394 protein localization to c
ell surface
 IMP biological_process
GO:0035257 nuclear hormone receptor
binding
 IPI molecular_function
GO:0035257 nuclear hormone receptor
binding
 TAS molecular_function
GO:0035315 hair cell differentiation
 TAS biological_process
GO:0035411 catenin import into nucle
us
 TAS biological_process
GO:0036023 embryonic skeletal limb j
oint morphogenesis
 ISS biological_process
GO:0042493 response to drug
 IEP biological_process
GO:0043065 positive regulation of ap
optotic process
 IDA biological_process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 TAS biological_process
GO:0043234 protein complex
 IDA cellular_component
GO:0043525 positive regulation of ne
uron apoptotic process
 IDA biological_process
GO:0044212 transcription regulatory
region DNA binding
 ISS molecular_function
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular_function
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular_function
GO:0044325 ion channel binding
 IPI molecular_function
GO:0044334 canonical Wnt signaling p
athway involved in positi
ve regulation of epitheli
al to mesenchymal transit
ion
 IMP biological_process
GO:0044336 canonical Wnt signaling p
athway involved in negati
ve regulation of apoptoti
c process
 IMP biological_process
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045294 alpha-catenin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045296 cadherin binding
 IPI molecular_function
GO:0045765 regulation of angiogenesi
s
 TAS biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IMP biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 ISS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological_process
GO:0045976 negative regulation of mi
totic cell cycle, embryon
ic
 ISS biological_process
GO:0046332 SMAD binding
 IPI molecular_function
GO:0048145 regulation of fibroblast
proliferation
 TAS biological_process
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular_component
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular_component
GO:0048660 regulation of smooth musc
le cell proliferation
 IMP biological_process
GO:0050681 androgen receptor binding
 NAS molecular_function
GO:0050767 regulation of neurogenesi
s
 TAS biological_process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
 IMP biological_process
GO:0051149 positive regulation of mu
scle cell differentiation
 TAS biological_process
GO:0051571 positive regulation of hi
stone H3-K4 methylation
 IC biological_process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological_process
GO:0061154 endothelial tube morphoge
nesis
 IMP biological_process
GO:0061324 canonical Wnt signaling p
athway involved in positi
ve regulation of cardiac
outflow tract cell prolif
eration
 ISS biological_process
GO:0061549 sympathetic ganglion deve
lopment
 ISS biological_process
GO:0070062 extracellular exosome
 IDA cellular_component
GO:0070369 beta-catenin-TCF7L2 compl
ex
 IDA cellular_component
GO:0070369 beta-catenin-TCF7L2 compl
ex
 IDA cellular_component
GO:0070411 I-SMAD binding
 IPI molecular_function
GO:0070602 regulation of centromeric
sister chromatid cohesio
n
 IMP biological_process
GO:0071363 cellular response to grow
th factor stimulus
 IMP biological_process
GO:0071681 cellular response to indo
le-3-methanol
 IDA biological_process
GO:0071944 cell periphery
 IDA cellular_component
GO:0072182 regulation of nephron tub
ule epithelial cell diffe
rentiation
 ISS biological_process
GO:0090279 regulation of calcium ion
import
 IDA biological_process
GO:1904837 beta-catenin-TCF complex
assembly
 TAS biological_process
GO:1904886 beta-catenin destruction
complex disassembly
 TAS biological_process
GO:1990188 euchromatin binding
 IDA molecular_function
GO:1990907 beta-catenin-TCF complex
 IPI cellular_component
GO:1990909 Wnt signalosome
 NAS cellular_component
GO:2000008 regulation of protein loc
alization to cell surface
 IDA biological_process
GO:2000144 positive regulation of DN
A-templated transcription
, initiation
 IC biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05418  Fluid shear stress and atherosclerosis
hsa05224  Breast cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05215  Prostate cancer
hsa04390  Hippo signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05210  Colorectal cancer
hsa04670  Leukocyte transendothelial migration
hsa04520  Adherens junction
hsa05213  Endometrial cancer
hsa04310  Wnt signaling pathway
hsa04916  Melanogenesis
hsa05100  Bacterial invasion of epithelial cells
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05130  Pathogenic Escherichia coli infection
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma

Diseases

Associated diseases References
Autosomal dominant mental retardation KEGG: H00773
Cancer PMID: 11429783
Chronic obstructive pulmonary disease (COPD) PMID: 19625176
Colorectal cancer KEGG: H00020
Ectopic pregnancy PMID: 23787212
Endometrial cancer PMID: 10671680
Endometrial cancer KEGG: H00026
Endometriosis PMID: 24661731
Fibromatosis PMID: 18832571
Gastric cancer KEGG: H00018
Hepatocellular carcinoma KEGG: H00048
Medulloblastoma KEGG: H01667
Ovarian endometriosis PMID: 8841809
Ovarian endometriosis PMID: 8841809
Pilomatricoma KEGG: H00947
Endometriosis associated infertility INFBASE20410224
Endometrial carcinoma INFBASE18295959
Endometriosis INFBASE10871648
Ovarian endometriosis INFBASE8841809
Sertoli cell-only syndrome (SCOS) PMID: 16036634
Spermatogenetic defects PMID: 16036634
Thyroid cancer KEGG: H00032

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24661731 Endometrio
sis
69 (30 with end
ometriosis, 39
women undergoin
g ICSI for male
infertility)
 WNT4
WNT5a
WNT1
?-catenin
BMP4
 Show abstract
25162724 Endometrio
sis
76 (36 endometr
iosis patients,
40 non endomet
riosis patients
)
 Female infertility MSI1
CTNNB1
 Show abstract
24018808 Endometrio
sis
67 ovarian endo
metrioid adenoc
arcinoma(35 ass
ociated with en
dometriosis, 32
without endome
triosis)
 Beta-catenin
cyclin D1
BAF250a
PTEN
p53
WT1
 Show abstract
20410224 Endometrio
sis
258 (151 infert
ile patients wi
th endometriosi
s, 41 uterine f
ibromas, 9 pati
ents with unexp
lained infertil
ity, 57 healthy
fertile contro
ls)
 Female infertility E-cadherin
beta-catenin
 Show abstract
18295959 Endometrio
sis
40 (15 endometr
iotic tissue, 1
5 low-grade end
ometrial endome
trioid carcinom
as, 10 unremark
able proliferat
ive endometrium
from women wit
hout endometrio
sis or carcinom
a)
 MMP-2
MMP-9
E-cadherin and beta-catenin
Show abstract
10871648 Endometrio
sis
115 (36 patient
s without endom
etriosis, 79 p
atients with, e
ndometriosis)
 EGF
EGFR
E-cadherin
beta-catenin
alpha- catenin
 Show abstract
8841809 Endometrio
sis (Ovari
an)

CDH1
CTNNA1
CTNNB1
 Show abstract
29630856 Endometrio
sis

CAS
CD147
nuclearB-cat
 Show abstract