Endometriosis Knowledgebase

Search Result

Gene id

1511

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CTSG Gene UCSC Ensembl

Aliases

CATG, CG

Gene name

cathepsin G

Alternate names

cathepsin G,

Gene location

14q12 (24576259: 24573517) Exons: 5 NC_000014.9

Gene summary(Entrez)

The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. In addition, the encoded protein is antimicrobial, with bacteriocidal activity against S. aureus and N. gonorrhoeae. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq, Sep 2014]

OMIM

116830

Protein Summary

Protein general information

P08311

Name: Cathepsin G (CG) (EC 3.4.21.20)

Length: 255 Mass: 28,837

Sequence

MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLG
AHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRV
SMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPP
EVFTRVSSFLPWIRTTMRSFKLLDQMETPL

Structural information

Protein Domains	Peptidase (21-243)
Interpro:	IPR009003 IPR001314 IPR001254 IPR018114 IPR033116
Prosite:	PS50240 PS00134 PS00135
Pfam:	PF00089
CDD:	cd00190
PDB:	1AU8 1CGH 1KYN 1T32
PDBsum:	1AU8 1CGH 1KYN 1T32
MINT:	4054534
STRING:	ENSP00000216336;

Other Databases

GeneCards: CTSG; Malacards: CTSG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002003	angiotensin maturation	TAS	biological_process
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0009986	cell surface	IEA	cellular_component
GO:0016485	protein processing	IBA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0050778	positive regulation of im mune response	IEA	biological_process
GO:0050832	defense response to fungu s	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070946	neutrophil mediated killi ng of gram-positive bacte rium	IEA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0002003	angiotensin maturation	TAS	biological_process
GO:0004252	serine-type endopeptidase activity	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008236	serine-type peptidase act ivity	IEA	molecular_function
GO:0009986	cell surface	IEA	cellular_component
GO:0016485	protein processing	IBA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0050778	positive regulation of im mune response	IEA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IEA	biological_process
GO:0050832	defense response to fungu s	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070946	neutrophil mediated killi ng of gram-positive bacte rium	IEA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0002003	angiotensin maturation	TAS	biological_process
GO:0004252	serine-type endopeptidase activity	EXP	molecular_function
GO:0004252	serine-type endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0016485	protein processing	IBA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component

KEGG pathways

hsa04080  Neuroactive ligand-receptor interaction
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
hsa04142  Lysosome
hsa04614  Renin-angiotensin system

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 11502364
Cardiovascular disease	PMID: 11557685
Endometriosis	PMID: 23466190
Kidney disease	PMID: 19578796
Metabolic syndrome	PMID: 19056482
Endometriosis	INFBASE23466190

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23466190	Endometrio sis			55 (31 patients with endometri osis (stages I- IV), 24 control s)		cathepsins B cathepsins D cathepsins G	Show abstract