Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1511
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CTSG   Gene   UCSC   Ensembl
Aliases CATG, CG
Gene name cathepsin G
Alternate names cathepsin G,
Gene location 14q12 (24576259: 24573517)     Exons: 5     NC_000014.9
Gene summary(Entrez) The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. In addition, the encoded protein is antimicrobial, with bacteriocidal activity against S. aureus and N. gonorrhoeae. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq, Sep 2014]
OMIM 116830

Protein Summary

Protein general information P08311  

Name: Cathepsin G (CG) (EC 3.4.21.20)

Length: 255  Mass: 28,837

Sequence MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLG
AHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRV
SMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPP
EVFTRVSSFLPWIRTTMRSFKLLDQMETPL
Structural information
Protein Domains
Peptidase (21-243)
Interpro:  IPR009003 IPR001314 IPR001254 IPR018114 IPR033116
Prosite:   PS50240 PS00134 PS00135

Pfam:  
PF00089
CDD:   cd00190

PDB:  
1AU8 1CGH 1KYN 1T32
PDBsum:   1AU8 1CGH 1KYN 1T32
MINT:   4054534
STRING:   ENSP00000216336;
Other Databases GeneCards:  CTSG;  Malacards:  CTSG

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0002003 angiotensin maturation
TAS biological_process
GO:0004252 serine-type endopeptidase
activity
EXP molecular_function
GO:0004252 serine-type endopeptidase
activity
IDA molecular_function
GO:0004252 serine-type endopeptidase
activity
IDA molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006468 protein phosphorylation
IDA biological_process
GO:0006508 proteolysis
IDA biological_process
GO:0006508 proteolysis
IDA biological_process
GO:0006955 immune response
TAS biological_process
GO:0008201 heparin binding
IDA molecular_function
GO:0008233 peptidase activity
IDA molecular_function
GO:0009986 cell surface
IEA cellular_component
GO:0016485 protein processing
IBA biological_process
GO:0022617 extracellular matrix disa
ssembly
TAS biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0044130 negative regulation of gr
owth of symbiont in host
IEA biological_process
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0050778 positive regulation of im
mune response
IEA biological_process
GO:0050832 defense response to fungu
s
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070946 neutrophil mediated killi
ng of gram-positive bacte
rium
IEA biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0002003 angiotensin maturation
TAS biological_process
GO:0004252 serine-type endopeptidase
activity
IEA molecular_function
GO:0004252 serine-type endopeptidase
activity
EXP molecular_function
GO:0004252 serine-type endopeptidase
activity
IDA molecular_function
GO:0004252 serine-type endopeptidase
activity
IDA molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006468 protein phosphorylation
IDA biological_process
GO:0006508 proteolysis
IEA biological_process
GO:0006508 proteolysis
IEA biological_process
GO:0006508 proteolysis
IDA biological_process
GO:0006508 proteolysis
IDA biological_process
GO:0006955 immune response
TAS biological_process
GO:0008201 heparin binding
IDA molecular_function
GO:0008233 peptidase activity
IEA molecular_function
GO:0008233 peptidase activity
IDA molecular_function
GO:0008236 serine-type peptidase act
ivity
IEA molecular_function
GO:0009986 cell surface
IEA cellular_component
GO:0016485 protein processing
IBA biological_process
GO:0016787 hydrolase activity
IEA molecular_function
GO:0022617 extracellular matrix disa
ssembly
TAS biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0042742 defense response to bacte
rium
IEA biological_process
GO:0044130 negative regulation of gr
owth of symbiont in host
IEA biological_process
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0050778 positive regulation of im
mune response
IEA biological_process
GO:0050830 defense response to Gram-
positive bacterium
IEA biological_process
GO:0050832 defense response to fungu
s
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070946 neutrophil mediated killi
ng of gram-positive bacte
rium
IEA biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0002003 angiotensin maturation
TAS biological_process
GO:0004252 serine-type endopeptidase
activity
EXP molecular_function
GO:0004252 serine-type endopeptidase
activity
IDA molecular_function
GO:0004252 serine-type endopeptidase
activity
IDA molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006468 protein phosphorylation
IDA biological_process
GO:0006508 proteolysis
IDA biological_process
GO:0006508 proteolysis
IDA biological_process
GO:0006955 immune response
TAS biological_process
GO:0008201 heparin binding
IDA molecular_function
GO:0008233 peptidase activity
IDA molecular_function
GO:0016485 protein processing
IBA biological_process
GO:0022617 extracellular matrix disa
ssembly
TAS biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0044267 cellular protein metaboli
c process
TAS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0031012 extracellular matrix
IDA cellular_component

KEGG pathways

hsa04080  Neuroactive ligand-receptor interaction
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
hsa04142  Lysosome
hsa04614  Renin-angiotensin system

Diseases

Associated diseases References
Alzheimer's disease PMID: 11502364
Cardiovascular disease PMID: 11557685
Endometriosis PMID: 23466190
Kidney disease PMID: 19578796
Metabolic syndrome PMID: 19056482
Endometriosis INFBASE23466190

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23466190 Endometrio
sis

55 (31 patients
with endometri
osis (stages I-
IV), 24 control
s)
cathepsins B
cathepsins D
cathepsins G
Show abstract