Endometriosis Knowledgebase

Search Result

Gene id

1544

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CYP1A2 Gene UCSC Ensembl

Aliases

CP12, P3-450, P450(PA)

Gene name

cytochrome P450 family 1 subfamily A member 2

Alternate names

cytochrome P450 1A2, CYPIA2, P450 form 4, aryl hydrocarbon hydroxylase, cholesterol 25-hydroxylase, cytochrome P(3)450, cytochrome P450 4, cytochrome P450, family 1, subfamily A, polypeptide 2, cytochrome P450, subfamily I (aromatic compound-inducible), polypepti,

Gene location

15q24.1 (74748842: 74756599) Exons: 7 NC_000015.10

Gene summary(Entrez)

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region. [provided by RefSeq, Jul 2008]

OMIM

124060

SNPs

rs762551

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000677.2   g.74749576C>A
NC_000015.10   g.74749576C>A
NC_000015.9   g.75041917C>A
NG_008431.2   g.32035C>A
NG_055245.1   g.5246C>A
NM_000761.4   c.-9-154C>A

Protein Summary

Protein general information

P05177

Name: Cytochrome P450 1A2 (EC 1.14.14.1) (CYPIA2) (Cholesterol 25 hydroxylase) (Cytochrome P(3)450) (Cytochrome P450 4) (Cytochrome P450 P3)

Length: 515 Mass: 58,294

Tissue specificity: Liver.

Sequence

MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQRYGDV
LQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLAQNALNTFSIA
SDPASSSSCYLEEHVSKEAKALISRLQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHE
FVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLSDRPQLPYLEAFILET
FRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPELWEDPSEFRPERFLTADGTAINKPLSEKMML
FGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGVKVDLTPIYGLTMKHARCEHVQARRFSIN

Structural information

Interpro:	IPR001128 IPR017972 IPR002401 IPR008066
Prosite:	PS00086
Pfam:	PF00067
PDB:	2HI4
PDBsum:	2HI4
STRING:	ENSP00000342007;

Other Databases

GeneCards: CYP1A2; Malacards: CYP1A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0005506	iron ion binding	IEA	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006706	steroid catabolic process	IMP	biological_process
GO:0006778	porphyrin-containing comp ound metabolic process	IEA	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0009055	electron carrier activity	TAS	molecular_function
GO:0009403	toxin biosynthetic proces s	IDA	biological_process
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0009820	alkaloid metabolic proces s	IDA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0016098	monoterpenoid metabolic p rocess	IDA	biological_process
GO:0016491	oxidoreductase activity	IDA	molecular_function
GO:0016491	oxidoreductase activity	IDA	molecular_function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n, reduced flavin or flav oprotein as one donor, an d incorporation of one at om of oxygen	IMP	molecular_function
GO:0017144	drug metabolic process	IDA	biological_process
GO:0017144	drug metabolic process	IDA	biological_process
GO:0018894	dibenzo-p-dioxin metaboli c process	IEA	biological_process
GO:0019373	epoxygenase P450 pathway	TAS	biological_process
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0030324	lung development	IEA	biological_process
GO:0032259	methylation	TAS	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032451	demethylase activity	IDA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032787	monocarboxylic acid metab olic process	IDA	biological_process
GO:0034875	caffeine oxidase activity	IDA	molecular_function
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0042737	drug catabolic process	IMP	biological_process
GO:0042738	exogenous drug catabolic process	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045333	cellular respiration	IEA	biological_process
GO:0046483	heterocycle metabolic pro cess	IDA	biological_process
GO:0050665	hydrogen peroxide biosynt hetic process	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0070330	aromatase activity	IEA	molecular_function
GO:0070989	oxidative demethylation	IDA	biological_process
GO:0071276	cellular response to cadm ium ion	IEA	biological_process
GO:0071615	oxidative deethylation	IDA	biological_process
GO:0097267	omega-hydroxylase P450 pa thway	TAS	biological_process
GO:0004497	monooxygenase activity	IEA	molecular_function
GO:0004497	monooxygenase activity	IEA	molecular_function
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0005506	iron ion binding	IEA	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006706	steroid catabolic process	IMP	biological_process
GO:0006725	cellular aromatic compoun d metabolic process	IEA	biological_process
GO:0006778	porphyrin-containing comp ound metabolic process	IEA	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0008202	steroid metabolic process	IEA	biological_process
GO:0009055	electron carrier activity	TAS	molecular_function
GO:0009403	toxin biosynthetic proces s	IDA	biological_process
GO:0009404	toxin metabolic process	IEA	biological_process
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0009820	alkaloid metabolic proces s	IDA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016098	monoterpenoid metabolic p rocess	IDA	biological_process
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016491	oxidoreductase activity	IDA	molecular_function
GO:0016491	oxidoreductase activity	IDA	molecular_function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n	IEA	molecular_function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n, reduced flavin or flav oprotein as one donor, an d incorporation of one at om of oxygen	IEA	molecular_function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n, reduced flavin or flav oprotein as one donor, an d incorporation of one at om of oxygen	IEA	molecular_function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n, reduced flavin or flav oprotein as one donor, an d incorporation of one at om of oxygen	IMP	molecular_function
GO:0017144	drug metabolic process	IEA	biological_process
GO:0017144	drug metabolic process	IDA	biological_process
GO:0017144	drug metabolic process	IDA	biological_process
GO:0018894	dibenzo-p-dioxin metaboli c process	IEA	biological_process
GO:0019373	epoxygenase P450 pathway	TAS	biological_process
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020037	heme binding	IEA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0030324	lung development	IEA	biological_process
GO:0031090	organelle membrane	IEA	cellular_component
GO:0032259	methylation	TAS	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032451	demethylase activity	IDA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032787	monocarboxylic acid metab olic process	IDA	biological_process
GO:0034875	caffeine oxidase activity	IDA	molecular_function
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042737	drug catabolic process	IMP	biological_process
GO:0042738	exogenous drug catabolic process	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045333	cellular respiration	IEA	biological_process
GO:0046483	heterocycle metabolic pro cess	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050665	hydrogen peroxide biosynt hetic process	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0070330	aromatase activity	IEA	molecular_function
GO:0070989	oxidative demethylation	IDA	biological_process
GO:0071276	cellular response to cadm ium ion	IEA	biological_process
GO:0071615	oxidative deethylation	IDA	biological_process
GO:0097267	omega-hydroxylase P450 pa thway	TAS	biological_process
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0004497	monooxygenase activity	TAS	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006706	steroid catabolic process	IMP	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0009055	electron carrier activity	TAS	molecular_function
GO:0009403	toxin biosynthetic proces s	IDA	biological_process
GO:0009820	alkaloid metabolic proces s	IDA	biological_process
GO:0016098	monoterpenoid metabolic p rocess	IDA	biological_process
GO:0016491	oxidoreductase activity	IDA	molecular_function
GO:0016491	oxidoreductase activity	IDA	molecular_function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n, reduced flavin or flav oprotein as one donor, an d incorporation of one at om of oxygen	IMP	molecular_function
GO:0017144	drug metabolic process	IDA	biological_process
GO:0017144	drug metabolic process	IDA	biological_process
GO:0019373	epoxygenase P450 pathway	TAS	biological_process
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0032259	methylation	TAS	biological_process
GO:0032451	demethylase activity	IDA	molecular_function
GO:0032787	monocarboxylic acid metab olic process	IDA	biological_process
GO:0034875	caffeine oxidase activity	IDA	molecular_function
GO:0042737	drug catabolic process	IMP	biological_process
GO:0042738	exogenous drug catabolic process	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0046483	heterocycle metabolic pro cess	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0070989	oxidative demethylation	IDA	biological_process
GO:0071615	oxidative deethylation	IDA	biological_process
GO:0097267	omega-hydroxylase P450 pa thway	TAS	biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa00140  Steroid hormone biosynthesis
hsa05204  Chemical carcinogenesis
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00830  Retinol metabolism
hsa00591  Linoleic acid metabolism
hsa00380  Tryptophan metabolism
hsa00232  Caffeine metabolism

Diseases

Associated diseases	References
Asthma	PMID: 12732846
Cryptorchidism	PMID: 22648180
Depression	PMID: 19593158
Endometrial cancer	PMID: 18318428
Endometriosis	PMID: 10764452
Fetal loss	PMID: 16782969
Hypospadias	PMID: 22648180
Macular degeneration	PMID: 15774926
Mental development	PMID: 19860743
Myocardial infarction	PMID: 15466009
Parkinson's disease	PMID: 18759349
Polydipsia	PMID: 16775389
Porphyria	PMID: 14714565
Recurrent miscarriage	PMID: 15299091
Rheumatoid arthritis	PMID: 18496682
Endometriosis	INFBASE10764452
Schizophrenia	PMID: 15505641
Tardive dyskinesia	PMID: 12790158

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
10764452	Endometrio sis	CYP1A1, CYP1A2, CYP1B1		43 (33 eutopic endometrial tis sue samples, 10 endometriotic tissue samples)	Female infertility	CYP1A1 CYP1A2 CYP1B1	Show abstract