Endometriosis Knowledgebase

Search Result

Gene id

1555

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CYP2B6 Gene UCSC Ensembl

Aliases

CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6, EFVM, IIB1, P450

Gene name

cytochrome P450 family 2 subfamily B member 6

Alternate names

cytochrome P450 2B6, 1,4-cineole 2-exo-monooxygenase, cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6,

Gene location

19q13.2 (40991199: 41018401) Exons: 11 NC_000019.10

Gene summary(Entrez)

This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008]

OMIM

123930

Protein Summary

Protein general information

P20813

Name: Cytochrome P450 2B6 (EC 1.14.13. ) (1,4 cineole 2 exo monooxygenase) (CYPIIB6) (Cytochrome P450 IIB1)

Length: 491 Mass: 56,278

Tissue specificity: Expressed in liver, lung and heart right ventricle. {ECO

Sequence

MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHLGPRPV
VMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEA
QCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLK
YFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHT
SFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKTEAFIPFSLGKRICLGEGIARAELFLFF
TTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLPR

Structural information

Interpro:	IPR001128 IPR017972 IPR002401 IPR008068
Prosite:	PS00086
Pfam:	PF00067
PDB:	3IBD 3QOA 3QU8 3UA5 4I91 4RQL 4RRT 4ZV8
PDBsum:	3IBD 3QOA 3QU8 3UA5 4I91 4RQL 4RRT 4ZV8
STRING:	ENSP00000324648;

Other Databases

GeneCards: CYP2B6; Malacards: CYP2B6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0005506	iron ion binding	IEA	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006805	xenobiotic metabolic proc ess	IDA	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0008202	steroid metabolic process	IMP	biological_process
GO:0008392	arachidonic acid epoxygen ase activity	IBA	molecular_function
GO:0008395	steroid hydroxylase activ ity	IBA	molecular_function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n, reduced flavin or flav oprotein as one donor, an d incorporation of one at om of oxygen	IEA	molecular_function
GO:0017144	drug metabolic process	IMP	biological_process
GO:0017144	drug metabolic process	IDA	biological_process
GO:0019373	epoxygenase P450 pathway	IBA	biological_process
GO:0019825	oxygen binding	TAS	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0042180	cellular ketone metabolic process	IDA	biological_process
GO:0042738	exogenous drug catabolic process	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0004497	monooxygenase activity	IEA	molecular_function
GO:0004497	monooxygenase activity	IEA	molecular_function
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0005506	iron ion binding	IEA	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006805	xenobiotic metabolic proc ess	IDA	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0008202	steroid metabolic process	IMP	biological_process
GO:0008392	arachidonic acid epoxygen ase activity	IBA	molecular_function
GO:0008395	steroid hydroxylase activ ity	IBA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n	IEA	molecular_function
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n, reduced flavin or flav oprotein as one donor, an d incorporation of one at om of oxygen	IEA	molecular_function
GO:0017144	drug metabolic process	IMP	biological_process
GO:0017144	drug metabolic process	IDA	biological_process
GO:0019373	epoxygenase P450 pathway	IBA	biological_process
GO:0019825	oxygen binding	TAS	molecular_function
GO:0020037	heme binding	IEA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0031090	organelle membrane	IEA	cellular_component
GO:0042180	cellular ketone metabolic process	IDA	biological_process
GO:0042738	exogenous drug catabolic process	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0046872	metal ion binding	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0004497	monooxygenase activity	IDA	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006805	xenobiotic metabolic proc ess	IDA	biological_process
GO:0006805	xenobiotic metabolic proc ess	TAS	biological_process
GO:0008202	steroid metabolic process	IMP	biological_process
GO:0008392	arachidonic acid epoxygen ase activity	IBA	molecular_function
GO:0008395	steroid hydroxylase activ ity	IBA	molecular_function
GO:0017144	drug metabolic process	IMP	biological_process
GO:0017144	drug metabolic process	IDA	biological_process
GO:0019373	epoxygenase P450 pathway	IBA	biological_process
GO:0019825	oxygen binding	TAS	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0042180	cellular ketone metabolic process	IDA	biological_process
GO:0042738	exogenous drug catabolic process	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa00590  Arachidonic acid metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00830  Retinol metabolism

Diseases

Associated diseases	References
Acute coronary syndrome	PMID: 19106084
Cancer	PMID: 12242601
Endometriosis	PMID: 22393305
Female infertility	PMID: 19342032
Idiopathic male infertility	PMID: 24488272
Pelvic endometriosis	PMID: 12372463
Polycystic ovary syndrome (PCOS)	PMID: 16798289
Premature ovarian failure ( POF)	PMID: 15248218
Female infertility	INFBASE22393305
Endometriosis	INFBASE22393305
Subfertility	INFBASE16708809
Female infertility	INFBASE12372463
Pelvic endometriosis	INFBASE12372463
Leiomyomas	INFBASE10593388
Adenomyosis	INFBASE10593388
Endometriosis	INFBASE10593388

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
22393305	Endometrio sis	122 (106 patien ts of dysmenorr hea and inferti lity, 16 endome triosis-free as ymptomatic pati ents)	Female infertility		Show abstract
19137777	Endometrio sis	40 (14 patients with ovarian e ndometriosis, 2 6 with adenomyo sis)			Show abstract
16708809	Endometrio sis	58 (36 endometr iosis women, 22 non-endometrio sis but subfert ility or pelvic pain women ser ved as controls )	Female infertility	P450 CA125	Show abstract
12372463	Endometrio sis (Pelvi c)	60 subjects of reproductive ag e undergoing la paroscopy for s ubfertility exp loration, pain assessment, or sterilization	Female infertility	P450	Show abstract
10593388	Endometrio sis	105 women of re productive age with normal men strual cycles u nderwent endome trial biopsy la parotomy or lap aroscopy, and e xamination of t heir tissue rev ealed endometri osis, adenomyos is, and/or leio myomas	Female infertility		Show abstract