Endometriosis Knowledgebase

Search Result

Gene id

1592

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CYP26A1 Gene UCSC Ensembl

Aliases

CP26, CYP26, P450RAI, P450RAI1

Gene name

cytochrome P450 family 26 subfamily A member 1

Alternate names

cytochrome P450 26A1, P450, retinoic acid-inactivating, 1, cytochrome P450 retinoic acid-inactivating 1, cytochrome P450, family 26, subfamily A, polypeptide 1, cytochrome P450, subfamily XXVIA, polypeptide 1, cytochrome P450RAI, hP450RAI, retinoic acid 4-hydrox,

Gene location

10q23.33 (93073474: 93077883) Exons: 8 NC_000010.11

Gene summary(Entrez)

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported. [provided by RefSeq, Jul 2008]

OMIM

602239

Protein Summary

Protein general information

O43174

Name: Cytochrome P450 26A1 (EC 1.14.13. ) (Cytochrome P450 retinoic acid inactivating 1) (Cytochrome P450RAI) (hP450RAI) (Retinoic acid 4 hydroxylase) (Retinoic acid metabolizing cytochrome)

Length: 497 Mass: 56,199

Tissue specificity: Highest levels in adult liver, heart, pituitary gland, adrenal gland, placenta and regions of the brain. {ECO

Sequence

MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQMKRRKY
GFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALE
CYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLP
IDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFR
VALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKI
LLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARFTHFHGEI

Structural information

Interpro:	IPR001128 IPR017972 IPR002403
Prosite:	PS00086
Pfam:	PF00067
STRING:	ENSP00000224356;

Other Databases

GeneCards: CYP26A1; Malacards: CYP26A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001972	retinoic acid binding	IDA	molecular_function
GO:0005506	iron ion binding	IEA	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006766	vitamin metabolic process	TAS	biological_process
GO:0008152	metabolic process	TAS	biological_process
GO:0008401	retinoic acid 4-hydroxyla se activity	IDA	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	IDA	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	TAS	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0020037	heme binding	NAS	molecular_function
GO:0034653	retinoic acid catabolic p rocess	IDA	biological_process
GO:0048387	negative regulation of re tinoic acid receptor sign aling pathway	TAS	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0001972	retinoic acid binding	IDA	molecular_function
GO:0004497	monooxygenase activity	IEA	molecular_function
GO:0004497	monooxygenase activity	IEA	molecular_function
GO:0005506	iron ion binding	IEA	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006766	vitamin metabolic process	TAS	biological_process
GO:0008152	metabolic process	TAS	biological_process
GO:0008401	retinoic acid 4-hydroxyla se activity	IDA	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	IDA	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	TAS	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or red uction of molecular oxyge n	IEA	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0020037	heme binding	IEA	molecular_function
GO:0020037	heme binding	NAS	molecular_function
GO:0031090	organelle membrane	IEA	cellular_component
GO:0034653	retinoic acid catabolic p rocess	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048387	negative regulation of re tinoic acid receptor sign aling pathway	TAS	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0001972	retinoic acid binding	IDA	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006766	vitamin metabolic process	TAS	biological_process
GO:0008152	metabolic process	TAS	biological_process
GO:0008401	retinoic acid 4-hydroxyla se activity	IDA	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	IDA	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	TAS	molecular_function
GO:0008401	retinoic acid 4-hydroxyla se activity	TAS	molecular_function
GO:0019825	oxygen binding	TAS	molecular_function
GO:0020037	heme binding	NAS	molecular_function
GO:0034653	retinoic acid catabolic p rocess	IDA	biological_process
GO:0048387	negative regulation of re tinoic acid receptor sign aling pathway	TAS	biological_process

KEGG pathways

hsa01100 Metabolic pathways
hsa00830 Retinol metabolism

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Endometriosis	PMID: 17510236
Glaucoma	PMID: 19553612
Neural tube defects	PMID: 16237707
Endometriosis	INFBASE17510236
Schizophrenia	PMID: 19703508

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17510236	Endometrio sis					FOXO1A MIG6 and CYP26A1	Show abstract