Endometriosis Knowledgebase

Search Result

Gene id

1603

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DAD1 Gene UCSC Ensembl

Aliases

OST2

Gene name

defender against cell death 1

Alternate names

dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, DAD-1, oligosaccharyl transferase subunit DAD1, oligosaccharyltransferase 2 homolog, oligosaccharyltransferase subunit 2 (non-catalytic),

Gene location

14q11.2 (22589236: 22564906) Exons: 3 NC_000014.9

Gene summary(Entrez)

DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008]

OMIM

600243

Protein Summary

Protein general information

P61803

Name: Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit DAD1 (Oligosaccharyl transferase subunit DAD1) (Defender against cell death 1) (DAD 1)

Length: 113 Mass: 12,497

Sequence

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRI
QINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Structural information

Interpro:	IPR003038
Pfam:	PF02109
STRING:	ENSP00000250498;

Other Databases

GeneCards: DAD1; Malacards: DAD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001824	blastocyst development	IEA	biological_process
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006486	protein glycosylation	ISS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008250	oligosaccharyltransferase complex	ISS	cellular_component
GO:0008250	oligosaccharyltransferase complex	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0018279	protein N-linked glycosyl ation via asparagine	IC	biological_process
GO:0018279	protein N-linked glycosyl ation via asparagine	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0004576	oligosaccharyl transferas e activity	ISS	molecular_function
GO:0004579	dolichyl-diphosphooligosa ccharide-protein glycotra nsferase activity	IC	molecular_function
GO:0001824	blastocyst development	IEA	biological_process
GO:0004579	dolichyl-diphosphooligosa ccharide-protein glycotra nsferase activity	IEA	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006486	protein glycosylation	ISS	biological_process
GO:0006486	protein glycosylation	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008250	oligosaccharyltransferase complex	IEA	cellular_component
GO:0008250	oligosaccharyltransferase complex	ISS	cellular_component
GO:0008250	oligosaccharyltransferase complex	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016740	transferase activity	IEA	molecular_function
GO:0016757	transferase activity, tra nsferring glycosyl groups	IEA	molecular_function
GO:0018279	protein N-linked glycosyl ation via asparagine	IC	biological_process
GO:0018279	protein N-linked glycosyl ation via asparagine	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0004576	oligosaccharyl transferas e activity	ISS	molecular_function
GO:0004579	dolichyl-diphosphooligosa ccharide-protein glycotra nsferase activity	IC	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006486	protein glycosylation	ISS	biological_process
GO:0008250	oligosaccharyltransferase complex	ISS	cellular_component
GO:0008250	oligosaccharyltransferase complex	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0018279	protein N-linked glycosyl ation via asparagine	IC	biological_process
GO:0018279	protein N-linked glycosyl ation via asparagine	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0004576	oligosaccharyl transferas e activity	ISS	molecular_function
GO:0004579	dolichyl-diphosphooligosa ccharide-protein glycotra nsferase activity	IC	molecular_function

KEGG pathways

hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
hsa00510  N-Glycan biosynthesis

Diseases

Associated diseases	References
Endometriosis	PMID: 17094974
Endometriosis	INFBASE17094974

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17094974	Endometrio sis			16 (10 women wi th endometriosi s, 6 without en dometriosis)		DAD-1 p53 Caspase-1	Show abstract