Endometriosis Knowledgebase

Search Result

Gene id

1612

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DAPK1 Gene UCSC Ensembl

Aliases

DAPK, ROCO3

Gene name

death associated protein kinase 1

Alternate names

death-associated protein kinase 1, DAP kinase 1,

Gene location

9q21.33 (44262215: 44246338) Exons: 12 NC_000021.9

Gene summary(Entrez)

Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

OMIM

600831

Protein Summary

Protein general information

P53355

Name: Death-associated protein kinase 1 (DAP kinase 1) (EC 2.7.11.1)

Length: 1430 Mass: 1,60,046

Tissue specificity: Isoform 2 is expressed in normal intestinal tissue as well as in colorectal carcinomas. {ECO

Sequence

MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPN
VITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDR
NVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET
LANVSAVNYEFEDEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGLQHLLGSLSNYDVNQP
NKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAARHGHVDTLKFLSENKCPLDVKDKSGEMALH
VAARYGHADVAQLLCSFGSNPNIQDKEEETPLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHD
IVECLAEHGADLNACDKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFI
QQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLY
PGCENVSVRSRSMMFEPGLTKGMLEVFVAPTHHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYD
YFAANDPTSIHVVVFSLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCPPMTHLCEKIISTLPS
WRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGEINIMQSETVQDVLLLDPRWLCTNVLGKLLS
VETPRALHHYRGRYTVEDIQRLVPDSDVEELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMV
YGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGY
KESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGAP
KDFLPSPLHALLREWTTYPESTVGTLMSKLRELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSIS
SVVSR

Structural information

Protein Domains	Protein (13-275) Roc. (681-955) Death. (1312-1396)
Interpro:	IPR002110 IPR020683 IPR036770 IPR020676 IPR011029 IPR000488 IPR011009 IPR027417 IPR000719 IPR017441 IPR020859 IPR008271
Prosite:	PS50297 PS50088 PS50017 PS00107 PS50011 PS00108 PS51424
Pfam:	PF12796 PF00531 PF00069
CDD:	cd00204
PDB:	1IG1 1JKK 1JKL 1JKS 1JKT 1P4F 1WVW 1WVX 1WVY 1YR5 2W4J 2W4K 2X0G 2XUU 2XZS 2Y0A 2Y4P 2Y4V 2YAK 3DFC 3DGK 3EH9 3EHA 3F5G 3F5U 3GU4 3GU5 3GU6 3GU7 3GU8 3GUB 3ZXT 4B4L 4PF4 4TL0 4TXC 4UV0 4YO4 4YPD 5AUT 5AUU 5AUV 5AUW 5AUX 5AUY 5AUZ 5AV0 5AV1 5AV2 5AV3 5AV4
PDBsum:	1IG1 1JKK 1JKL 1JKS 1JKT 1P4F 1WVW 1WVX 1WVY 1YR5 2W4J 2W4K 2X0G 2XUU 2XZS 2Y0A 2Y4P 2Y4V 2YAK 3DFC 3DGK 3EH9 3EHA 3F5G 3F5U 3GU4 3GU5 3GU6 3GU7 3GU8 3GUB 3ZXT 4B4L 4PF4 4TL0 4TXC 4UV0 4YO4 4YPD 5AUT 5AUU 5AUV 5AUW 5AUX 5AUY 5AUZ 5AV0 5AV1 5AV2 5AV3 5AV4
MINT:
STRING:	ENSP00000350785;

Other Databases

GeneCards: DAPK1; Malacards: DAPK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004683	calmodulin-dependent prot ein kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005516	calmodulin binding	IDA	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006915	apoptotic process	IMP	biological_process
GO:0006915	apoptotic process	IGI	biological_process
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IEA	biological_process
GO:0010506	regulation of autophagy	TAS	biological_process
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0017075	syntaxin-1 binding	IPI	molecular_function
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	TAS	biological_process
GO:0071346	cellular response to inte rferon-gamma	IDA	biological_process
GO:0097190	apoptotic signaling pathw ay	IMP	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IEA	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	ISS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004683	calmodulin-dependent prot ein kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005516	calmodulin binding	IEA	molecular_function
GO:0005516	calmodulin binding	IDA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006417	regulation of translation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IMP	biological_process
GO:0006915	apoptotic process	IGI	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0008625	extrinsic apoptotic signa ling pathway via death do main receptors	IEA	biological_process
GO:0010506	regulation of autophagy	TAS	biological_process
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0017075	syntaxin-1 binding	IPI	molecular_function
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	TAS	biological_process
GO:0071346	cellular response to inte rferon-gamma	IDA	biological_process
GO:0097190	apoptotic signaling pathw ay	IMP	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IEA	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	IEA	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	ISS	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004683	calmodulin-dependent prot ein kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005516	calmodulin binding	IDA	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006915	apoptotic process	IMP	biological_process
GO:0006915	apoptotic process	IGI	biological_process
GO:0010506	regulation of autophagy	TAS	biological_process
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0017075	syntaxin-1 binding	IPI	molecular_function
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	TAS	biological_process
GO:0071346	cellular response to inte rferon-gamma	IDA	biological_process
GO:0097190	apoptotic signaling pathw ay	IMP	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	ISS	biological_process

KEGG pathways

hsa04140  Autophagy - animal
hsa05219  Bladder cancer
hsa05200  Pathways in cancer

Diseases

Associated diseases	References
Endometriosis	INFBASE26191186
Bladder cancer	KEGGH00022

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26191186	Endometrio sis					MIR191 DAPK1	Show abstract