Endometriosis Knowledgebase

Search Result

Gene id

1634

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DCN Gene UCSC Ensembl

Aliases

CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B

Gene name

decorin

Alternate names

decorin, bone proteoglycan II, dermatan sulphate proteoglycans II, proteoglycan core protein, small leucine-rich protein 1B,

Gene location

12q21.33 (91183123: 91143276) Exons: 12 NC_000012.12

Gene summary(Entrez)

This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. [provided by RefSeq, Nov 2015]

OMIM

125255

Protein Summary

Protein general information

P07585

Name: Decorin (Bone proteoglycan II) (PG-S2) (PG40)

Length: 359 Mass: 39,747

Sequence

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKV
PKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPK
TLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTE
LHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Structural information

Interpro:	IPR028549 IPR001611 IPR003591 IPR032675 IPR000372 IPR016352
Prosite:	PS51450
Pfam:	PF13855 PF01462
STRING:	ENSP00000052754;

Other Databases

GeneCards: DCN; Malacards: DCN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001822	kidney development	IEA	biological_process
GO:0001890	placenta development	IEA	biological_process
GO:0004860	protein kinase inhibitor activity	IBA	molecular_function
GO:0005518	collagen binding	IEA	molecular_function
GO:0005539	glycosaminoglycan binding	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005589	collagen type VI trimer	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IBA	biological_process
GO:0007519	skeletal muscle tissue de velopment	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009887	animal organ morphogenesi s	TAS	biological_process
GO:0010508	positive regulation of au tophagy	IDA	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0016239	positive regulation of ma croautophagy	IDA	biological_process
GO:0016239	positive regulation of ma croautophagy	IGI	biological_process
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0019800	peptide cross-linking via chondroitin 4-sulfate gl ycosaminoglycan	IEA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0030206	chondroitin sulfate biosy nthetic process	TAS	biological_process
GO:0030207	chondroitin sulfate catab olic process	TAS	biological_process
GO:0030208	dermatan sulfate biosynth etic process	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0050840	extracellular matrix bind ing	IEA	molecular_function
GO:0051901	positive regulation of mi tochondrial depolarizatio n	IGI	biological_process
GO:0090141	positive regulation of mi tochondrial fission	IGI	biological_process
GO:1900747	negative regulation of va scular endothelial growth factor signaling pathway	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0001822	kidney development	IEA	biological_process
GO:0001890	placenta development	IEA	biological_process
GO:0004860	protein kinase inhibitor activity	IBA	molecular_function
GO:0005518	collagen binding	IEA	molecular_function
GO:0005518	collagen binding	IEA	molecular_function
GO:0005539	glycosaminoglycan binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005589	collagen type VI trimer	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IBA	biological_process
GO:0007519	skeletal muscle tissue de velopment	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009887	animal organ morphogenesi s	TAS	biological_process
GO:0010508	positive regulation of au tophagy	IDA	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0016239	positive regulation of ma croautophagy	IDA	biological_process
GO:0016239	positive regulation of ma croautophagy	IGI	biological_process
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0019800	peptide cross-linking via chondroitin 4-sulfate gl ycosaminoglycan	IEA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0030206	chondroitin sulfate biosy nthetic process	TAS	biological_process
GO:0030207	chondroitin sulfate catab olic process	TAS	biological_process
GO:0030208	dermatan sulfate biosynth etic process	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0050840	extracellular matrix bind ing	IEA	molecular_function
GO:0051901	positive regulation of mi tochondrial depolarizatio n	IGI	biological_process
GO:0090141	positive regulation of mi tochondrial fission	IGI	biological_process
GO:1900747	negative regulation of va scular endothelial growth factor signaling pathway	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0004860	protein kinase inhibitor activity	IBA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IBA	biological_process
GO:0009887	animal organ morphogenesi s	TAS	biological_process
GO:0010508	positive regulation of au tophagy	IDA	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0016239	positive regulation of ma croautophagy	IDA	biological_process
GO:0016239	positive regulation of ma croautophagy	IGI	biological_process
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0030206	chondroitin sulfate biosy nthetic process	TAS	biological_process
GO:0030207	chondroitin sulfate catab olic process	TAS	biological_process
GO:0030208	dermatan sulfate biosynth etic process	TAS	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0051901	positive regulation of mi tochondrial depolarizatio n	IGI	biological_process
GO:0090141	positive regulation of mi tochondrial fission	IGI	biological_process
GO:1900747	negative regulation of va scular endothelial growth factor signaling pathway	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component

KEGG pathways

hsa05205 Proteoglycans in cancer
hsa04350 TGF-beta signaling pathway

Diseases

Associated diseases	References
Renal disease	GAD12187087
Ovarian cancer	GAD20628624
Myopia	GAD16902402
Heart defects	GAD20445134
Diabetes	GAD15926114
Breast cancer	GAD19036156
Bladder cancer	GAD19590686
Corneal dystrophy	OMIM610048
Endometriosis	PubMed25244916
Congenital stromal corneal dystrophy	KEGGH00958

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25244916	Endometrio sis			50 endometriosi s patients			Show abstract