Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1808
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol DPYSL2   Gene   UCSC   Ensembl
Aliases CRMP-2, CRMP2, DHPRP2, DRP-2, DRP2, N2A3, ULIP-2, ULIP2
Gene name dihydropyrimidinase like 2
Alternate names dihydropyrimidinase-related protein 2, collapsin response mediator protein hCRMP-2, unc-33-like phosphoprotein 2,
Gene location 8p21.2 (26514192: 26658176)     Exons: 16     NC_000008.11
Gene summary(Entrez) This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
OMIM 602463

Protein Summary

Protein general information Q16555  

Name: Dihydropyrimidinase related protein 2 (DRP 2) (Collapsin response mediator protein 2) (CRMP 2) (N2A3) (Unc 33 like phosphoprotein 2) (ULIP 2)

Length: 572  Mass: 62,294

Tissue specificity: Ubiquitous.

Sequence MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTR
FQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQE
EMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVL
SRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA
FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKM
DENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQG
KIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAK
QQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
Structural information
Interpro:  IPR006680 IPR030615 IPR011778 IPR011059 IPR032466

Pfam:  
PF01979
CDD:   cd01314

PDB:  
2GSE 2VM8 5LXX 5MKV 5MLE
PDBsum:   2GSE 2VM8 5LXX 5MKV 5MLE
MINT:   3032752
STRING:   ENSP00000309539;
Other Databases GeneCards:  DPYSL2;  Malacards:  DPYSL2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001975 response to amphetamine
IEA biological_process
GO:0004157 dihydropyrimidinase activ
ity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005739 mitochondrion
IEA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006139 nucleobase-containing com
pound metabolic process
TAS biological_process
GO:0006897 endocytosis
IMP biological_process
GO:0007010 cytoskeleton organization
ISS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007399 nervous system developmen
t
TAS biological_process
GO:0007411 axon guidance
IEA biological_process
GO:0008017 microtubule binding
IEA molecular_function
GO:0014049 positive regulation of gl
utamate secretion
IEA biological_process
GO:0019901 protein kinase binding
IEA molecular_function
GO:0021510 spinal cord development
IEA biological_process
GO:0021772 olfactory bulb developmen
t
IEA biological_process
GO:0030425 dendrite
IEA cellular_component
GO:0030426 growth cone
IEA cellular_component
GO:0030516 regulation of axon extens
ion
IEA biological_process
GO:0042220 response to cocaine
IEA biological_process
GO:0042493 response to drug
IEA biological_process
GO:0043025 neuronal cell body
IEA cellular_component
GO:0043195 terminal bouton
IEA cellular_component
GO:0043209 myelin sheath
IEA cellular_component
GO:0043234 protein complex
IEA cellular_component
GO:0048489 synaptic vesicle transpor
t
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0005874 microtubule
IDA cellular_component
GO:0016020 membrane
IDA cellular_component
GO:0001975 response to amphetamine
IEA biological_process
GO:0004157 dihydropyrimidinase activ
ity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005739 mitochondrion
IEA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005856 cytoskeleton
IEA cellular_component
GO:0005856 cytoskeleton
IEA cellular_component
GO:0006139 nucleobase-containing com
pound metabolic process
TAS biological_process
GO:0006897 endocytosis
IMP biological_process
GO:0007010 cytoskeleton organization
IEA biological_process
GO:0007010 cytoskeleton organization
IEA biological_process
GO:0007010 cytoskeleton organization
ISS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0007399 nervous system developmen
t
IEA biological_process
GO:0007399 nervous system developmen
t
TAS biological_process
GO:0007411 axon guidance
IEA biological_process
GO:0007420 brain development
IEA biological_process
GO:0007420 brain development
IEA biological_process
GO:0008017 microtubule binding
IEA molecular_function
GO:0010975 regulation of neuron proj
ection development
IEA biological_process
GO:0014049 positive regulation of gl
utamate secretion
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016787 hydrolase activity
IEA molecular_function
GO:0016810 hydrolase activity, actin
g on carbon-nitrogen (but
not peptide) bonds
IEA molecular_function
GO:0019901 protein kinase binding
IEA molecular_function
GO:0021510 spinal cord development
IEA biological_process
GO:0021772 olfactory bulb developmen
t
IEA biological_process
GO:0030154 cell differentiation
IEA biological_process
GO:0030424 axon
IEA cellular_component
GO:0030425 dendrite
IEA cellular_component
GO:0030426 growth cone
IEA cellular_component
GO:0030516 regulation of axon extens
ion
IEA biological_process
GO:0042220 response to cocaine
IEA biological_process
GO:0042493 response to drug
IEA biological_process
GO:0043005 neuron projection
IEA cellular_component
GO:0043025 neuronal cell body
IEA cellular_component
GO:0043195 terminal bouton
IEA cellular_component
GO:0043209 myelin sheath
IEA cellular_component
GO:0043234 protein complex
IEA cellular_component
GO:0045664 regulation of neuron diff
erentiation
IEA biological_process
GO:0045664 regulation of neuron diff
erentiation
IEA biological_process
GO:0048489 synaptic vesicle transpor
t
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0005874 microtubule
IDA cellular_component
GO:0016020 membrane
IDA cellular_component
GO:0004157 dihydropyrimidinase activ
ity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006139 nucleobase-containing com
pound metabolic process
TAS biological_process
GO:0006897 endocytosis
IMP biological_process
GO:0007010 cytoskeleton organization
ISS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007399 nervous system developmen
t
TAS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0005874 microtubule
IDA cellular_component
GO:0016020 membrane
IDA cellular_component

KEGG pathways

hsa04360  Axon guidance

Diseases

Associated diseases References
Bipolar disorder PMID: 19328558
Endometriosis PMID: 23670619
Schizophrenia PMID: 16380905
Endometriosis INFBASE23670619

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23670619 Endometrio
sis

18 ( 9 eutopic
endometrial cel
ls collected fr
om females with
endometriosis,
9 eutopic endo
metrial cells c
ollected from f
emales without
endometriosis)
Female infertility CXCR4
SOX2
MET
CRMP2
Oct4
Show abstract