Endometriosis Knowledgebase

Search Result

Gene id

1813

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DRD2 Gene UCSC Ensembl

Aliases

D2DR, D2R

Gene name

dopamine receptor D2

Alternate names

D(2) dopamine receptor, dopamine D2 receptor, dopamine receptor D2 isoform, seven transmembrane helix receptor,

Gene location

11q23.2 (113475278: 113409594) Exons: 9 NC_000011.10

Gene summary(Entrez)

This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing. [provided by RefSeq, Jul 2008]

OMIM

126450

SNPs

rs6277

Strand: -   Allele origin: unknown  Allele change: C/T   Mutation type: snp


NC_000011.9   g.113283459G>A
NC_000011.10   g.113412737G>A
NG_008841.1   g.67543C>T
NM_000795.3   c.957C>T
NM_016574.3   c.870C>T
NP_057658.2   p.Pro290=
NP_000786.1   p.Pro319=
XM_005271425.1   c.957C>T
XM_005271426.1   c.954C>T
XM_017017296.1   c.957C>T
XP_005271483.1   p.P
Clinical Significance: Benign

rs2283265

Strand: -   Allele origin: unknown  Allele change: G/T   Mutation type: snp

NC_000011.9   g.113285536C>A
NC_000011.10   g.113414814C>A
NG_008841.1   g.65466G>T
NM_000795.3   c.724-353G>T
NM_016574.3   c.723+607G>T
XM_005271425.1   c.724-353G>T
XM_005271426.1   c.721-353G>T
XM_017017296.1   c.724-353G>T
rs4245146

Strand: +   Allele origin: unknown  Allele change: C/T   Mutation type: snp


NC_000011.9   g.113317973T>C
NC_000011.10   g.113447251T>C
NG_008841.1   g.33029A>G
NM_000795.3   c.-31-22569A>G
NM_016574.3   c.-31-22569A>G
XM_005271425.1   c.-31-22569A>G
XM_017017296.1   c.-31-22569A>G
rs4648317

Strand: -   Allele origin: unknown  Allele change: C/T   Mutation type: snp

NC_000011.10   g.113460810G>A
NC_000011.9   g.113331532G>A
NG_008841.1   g.19470C>T
NM_000795.3   c.-32+14266C>T
NM_016574.3   c.-32+14266C>T
XM_005271425.1   c.-32+14848C>T
XM_017017296.1   c.-32+13420C>T

Protein Summary

Protein general information

P14416

Name: D(2) dopamine receptor (Dopamine D2 receptor)

Length: 443 Mass: 50,619

Sequence

MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVS
LAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR
RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNT
KRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML
AIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Structural information

Interpro:	IPR001922 IPR000929 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
PDB:	1I15 5AER
PDBsum:	1I15 5AER
DIP:	5977
MINT:	201447
STRING:	ENSP00000354859;

Other Databases

GeneCards: DRD2; Malacards: DRD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001669	acrosomal vesicle	IEA	cellular_component
GO:0001963	synaptic transmission, do paminergic	IBA	biological_process
GO:0001975	response to amphetamine	ISS	biological_process
GO:0001976	neurological system proce ss involved in regulation of systemic arterial blo od pressure	ISS	biological_process
GO:0002027	regulation of heart rate	ISS	biological_process
GO:0002028	regulation of sodium ion transport	ISS	biological_process
GO:0002031	G-protein coupled recepto r internalization	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	ISS	biological_process
GO:0002092	positive regulation of re ceptor internalization	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006874	cellular calcium ion home ostasis	IC	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IEA	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IDA	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007270	neuron-neuron synaptic tr ansmission	ISS	biological_process
GO:0007409	axonogenesis	ISS	biological_process
GO:0007416	synapse assembly	ISS	biological_process
GO:0007608	sensory perception of sme ll	ISS	biological_process
GO:0007616	long-term memory	IEA	biological_process
GO:0007625	grooming behavior	IEA	biological_process
GO:0007626	locomotory behavior	ISS	biological_process
GO:0007628	adult walking behavior	ISS	biological_process
GO:0007631	feeding behavior	IEA	biological_process
GO:0008104	protein localization	ISS	biological_process
GO:0008144	drug binding	IDA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	ISS	biological_process
GO:0008306	associative learning	ISS	biological_process
GO:0008542	visual learning	ISS	biological_process
GO:0009416	response to light stimulu s	ISS	biological_process
GO:0009636	response to toxic substan ce	IBA	biological_process
GO:0010039	response to iron ion	IEA	biological_process
GO:0014059	regulation of dopamine se cretion	IBA	biological_process
GO:0014069	postsynaptic density	IEA	cellular_component
GO:0014854	response to inactivity	IEA	biological_process
GO:0015459	potassium channel regulat or activity	NAS	molecular_function
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016328	lateral plasma membrane	IEA	cellular_component
GO:0021756	striatum development	IEA	biological_process
GO:0021769	orbitofrontal cortex deve lopment	IEA	biological_process
GO:0021853	cerebral cortex GABAergic interneuron migration	ISS	biological_process
GO:0021984	adenohypophysis developme nt	ISS	biological_process
GO:0030139	endocytic vesicle	IEA	cellular_component
GO:0030336	negative regulation of ce ll migration	ISS	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0030432	peristalsis	ISS	biological_process
GO:0030672	synaptic vesicle membrane	IBA	cellular_component
GO:0030814	regulation of cAMP metabo lic process	IDA	biological_process
GO:0031223	auditory behavior	IEA	biological_process
GO:0032147	activation of protein kin ase activity	IEA	biological_process
GO:0032228	regulation of synaptic tr ansmission, GABAergic	ISS	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033602	negative regulation of do pamine secretion	IEA	biological_process
GO:0034776	response to histamine	IDA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035240	dopamine binding	IBA	molecular_function
GO:0035255	ionotropic glutamate rece ptor binding	IEA	molecular_function
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035810	positive regulation of ur ine volume	IEA	biological_process
GO:0035815	positive regulation of re nal sodium excretion	IEA	biological_process
GO:0036126	sperm flagellum	IEA	cellular_component
GO:0040018	positive regulation of mu lticellular organism grow th	IEA	biological_process
GO:0042220	response to cocaine	ISS	biological_process
GO:0042321	negative regulation of ci rcadian sleep/wake cycle, sleep	IEA	biological_process
GO:0042417	dopamine metabolic proces s	IC	biological_process
GO:0042493	response to drug	ISS	biological_process
GO:0042493	response to drug	IBA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043266	regulation of potassium i on transport	ISS	biological_process
GO:0043266	regulation of potassium i on transport	IBA	biological_process
GO:0043278	response to morphine	ISS	biological_process
GO:0043473	pigmentation	IEA	biological_process
GO:0043666	regulation of phosphoprot ein phosphatase activity	IEA	biological_process
GO:0043679	axon terminus	IEA	cellular_component
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	ISS	biological_process
GO:0045824	negative regulation of in nate immune response	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046488	phosphatidylinositol meta bolic process	ISS	biological_process
GO:0046676	negative regulation of in sulin secretion	IEA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048148	behavioral response to co caine	ISS	biological_process
GO:0048148	behavioral response to co caine	IBA	biological_process
GO:0048149	behavioral response to et hanol	ISS	biological_process
GO:0048149	behavioral response to et hanol	IBA	biological_process
GO:0048169	regulation of long-term n euronal synaptic plastici ty	ISS	biological_process
GO:0048678	response to axon injury	IEA	biological_process
GO:0048755	branching morphogenesis o f a nerve	ISS	biological_process
GO:0050482	arachidonic acid secretio n	IDA	biological_process
GO:0050709	negative regulation of pr otein secretion	IDA	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	ISS	biological_process
GO:0051481	negative regulation of cy tosolic calcium ion conce ntration	IBA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IDA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IDA	biological_process
GO:0051584	regulation of dopamine up take involved in synaptic transmission	IC	biological_process
GO:0051586	positive regulation of do pamine uptake involved in synaptic transmission	ISS	biological_process
GO:0051823	regulation of synapse str uctural plasticity	IEA	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	ISS	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	NAS	biological_process
GO:0051967	negative regulation of sy naptic transmission, glut amatergic	ISS	biological_process
GO:0051967	negative regulation of sy naptic transmission, glut amatergic	IBA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	ISS	biological_process
GO:0060134	prepulse inhibition	ISS	biological_process
GO:0060158	phospholipase C-activatin g dopamine receptor signa ling pathway	IGI	biological_process
GO:0060160	negative regulation of do pamine receptor signaling pathway	ISS	biological_process
GO:0060170	ciliary membrane	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0090325	regulation of locomotion involved in locomotory be havior	IEA	biological_process
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:1900168	positive regulation of gl ial cell-derived neurotro phic factor secretion	IDA	biological_process
GO:1900273	positive regulation of lo ng-term synaptic potentia tion	IEA	biological_process
GO:1901386	negative regulation of vo ltage-gated calcium chann el activity	IEA	biological_process
GO:1901386	negative regulation of vo ltage-gated calcium chann el activity	IDA	biological_process
GO:0004935	adrenergic receptor activ ity	IBA	molecular_function
GO:0071880	adenylate cyclase-activat ing adrenergic receptor s ignaling pathway	IBA	biological_process
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IEA	molecular_function
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001659	temperature homeostasis	IEA	biological_process
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001669	acrosomal vesicle	IEA	cellular_component
GO:0001963	synaptic transmission, do paminergic	IEA	biological_process
GO:0001963	synaptic transmission, do paminergic	IBA	biological_process
GO:0001964	startle response	IEA	biological_process
GO:0001975	response to amphetamine	IEA	biological_process
GO:0001975	response to amphetamine	ISS	biological_process
GO:0001976	neurological system proce ss involved in regulation of systemic arterial blo od pressure	IEA	biological_process
GO:0001976	neurological system proce ss involved in regulation of systemic arterial blo od pressure	ISS	biological_process
GO:0002027	regulation of heart rate	IEA	biological_process
GO:0002027	regulation of heart rate	ISS	biological_process
GO:0002028	regulation of sodium ion transport	IEA	biological_process
GO:0002028	regulation of sodium ion transport	ISS	biological_process
GO:0002031	G-protein coupled recepto r internalization	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	ISS	biological_process
GO:0002092	positive regulation of re ceptor internalization	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004952	dopamine neurotransmitter receptor activity	IEA	molecular_function
GO:0004952	dopamine neurotransmitter receptor activity	IEA	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006874	cellular calcium ion home ostasis	IC	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007188	adenylate cyclase-modulat ing G-protein coupled rec eptor signaling pathway	IEA	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IEA	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IDA	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IEA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IEA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007212	dopamine receptor signali ng pathway	IEA	biological_process
GO:0007270	neuron-neuron synaptic tr ansmission	IEA	biological_process
GO:0007270	neuron-neuron synaptic tr ansmission	ISS	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007409	axonogenesis	ISS	biological_process
GO:0007416	synapse assembly	IEA	biological_process
GO:0007416	synapse assembly	ISS	biological_process
GO:0007608	sensory perception of sme ll	IEA	biological_process
GO:0007608	sensory perception of sme ll	ISS	biological_process
GO:0007616	long-term memory	IEA	biological_process
GO:0007625	grooming behavior	IEA	biological_process
GO:0007626	locomotory behavior	IEA	biological_process
GO:0007626	locomotory behavior	ISS	biological_process
GO:0007628	adult walking behavior	IEA	biological_process
GO:0007628	adult walking behavior	ISS	biological_process
GO:0007631	feeding behavior	IEA	biological_process
GO:0008104	protein localization	IEA	biological_process
GO:0008104	protein localization	ISS	biological_process
GO:0008144	drug binding	IEA	molecular_function
GO:0008144	drug binding	IDA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	ISS	biological_process
GO:0008306	associative learning	IEA	biological_process
GO:0008306	associative learning	ISS	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0008542	visual learning	ISS	biological_process
GO:0009416	response to light stimulu s	IEA	biological_process
GO:0009416	response to light stimulu s	ISS	biological_process
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0009636	response to toxic substan ce	IBA	biological_process
GO:0010039	response to iron ion	IEA	biological_process
GO:0014059	regulation of dopamine se cretion	IEA	biological_process
GO:0014059	regulation of dopamine se cretion	IBA	biological_process
GO:0014069	postsynaptic density	IEA	cellular_component
GO:0014854	response to inactivity	IEA	biological_process
GO:0015459	potassium channel regulat or activity	NAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016328	lateral plasma membrane	IEA	cellular_component
GO:0021756	striatum development	IEA	biological_process
GO:0021769	orbitofrontal cortex deve lopment	IEA	biological_process
GO:0021853	cerebral cortex GABAergic interneuron migration	IEA	biological_process
GO:0021853	cerebral cortex GABAergic interneuron migration	ISS	biological_process
GO:0021984	adenohypophysis developme nt	IEA	biological_process
GO:0021984	adenohypophysis developme nt	ISS	biological_process
GO:0030139	endocytic vesicle	IEA	cellular_component
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	ISS	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	IEA	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0030432	peristalsis	IEA	biological_process
GO:0030432	peristalsis	ISS	biological_process
GO:0030534	adult behavior	IEA	biological_process
GO:0030672	synaptic vesicle membrane	IEA	cellular_component
GO:0030672	synaptic vesicle membrane	IBA	cellular_component
GO:0030814	regulation of cAMP metabo lic process	IDA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031223	auditory behavior	IEA	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0032147	activation of protein kin ase activity	IEA	biological_process
GO:0032228	regulation of synaptic tr ansmission, GABAergic	IEA	biological_process
GO:0032228	regulation of synaptic tr ansmission, GABAergic	ISS	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032922	circadian regulation of g ene expression	IEA	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033602	negative regulation of do pamine secretion	IEA	biological_process
GO:0034776	response to histamine	IDA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035240	dopamine binding	IEA	molecular_function
GO:0035240	dopamine binding	IBA	molecular_function
GO:0035255	ionotropic glutamate rece ptor binding	IEA	molecular_function
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035810	positive regulation of ur ine volume	IEA	biological_process
GO:0035815	positive regulation of re nal sodium excretion	IEA	biological_process
GO:0036126	sperm flagellum	IEA	cellular_component
GO:0040018	positive regulation of mu lticellular organism grow th	IEA	biological_process
GO:0042220	response to cocaine	IEA	biological_process
GO:0042220	response to cocaine	ISS	biological_process
GO:0042321	negative regulation of ci rcadian sleep/wake cycle, sleep	IEA	biological_process
GO:0042417	dopamine metabolic proces s	IEA	biological_process
GO:0042417	dopamine metabolic proces s	IC	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042493	response to drug	ISS	biological_process
GO:0042493	response to drug	IBA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043266	regulation of potassium i on transport	IEA	biological_process
GO:0043266	regulation of potassium i on transport	ISS	biological_process
GO:0043266	regulation of potassium i on transport	IBA	biological_process
GO:0043278	response to morphine	IEA	biological_process
GO:0043278	response to morphine	ISS	biological_process
GO:0043408	regulation of MAPK cascad e	IEA	biological_process
GO:0043473	pigmentation	IEA	biological_process
GO:0043666	regulation of phosphoprot ein phosphatase activity	IEA	biological_process
GO:0043679	axon terminus	IEA	cellular_component
GO:0045471	response to ethanol	IEA	biological_process
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	ISS	biological_process
GO:0045824	negative regulation of in nate immune response	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046488	phosphatidylinositol meta bolic process	IEA	biological_process
GO:0046488	phosphatidylinositol meta bolic process	ISS	biological_process
GO:0046676	negative regulation of in sulin secretion	IEA	biological_process
GO:0046717	acid secretion	IEA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048148	behavioral response to co caine	IEA	biological_process
GO:0048148	behavioral response to co caine	ISS	biological_process
GO:0048148	behavioral response to co caine	IBA	biological_process
GO:0048149	behavioral response to et hanol	IEA	biological_process
GO:0048149	behavioral response to et hanol	ISS	biological_process
GO:0048149	behavioral response to et hanol	IBA	biological_process
GO:0048169	regulation of long-term n euronal synaptic plastici ty	IEA	biological_process
GO:0048169	regulation of long-term n euronal synaptic plastici ty	ISS	biological_process
GO:0048678	response to axon injury	IEA	biological_process
GO:0048755	branching morphogenesis o f a nerve	IEA	biological_process
GO:0048755	branching morphogenesis o f a nerve	ISS	biological_process
GO:0050482	arachidonic acid secretio n	IDA	biological_process
GO:0050709	negative regulation of pr otein secretion	IDA	biological_process
GO:0050804	modulation of synaptic tr ansmission	IEA	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	IEA	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	ISS	biological_process
GO:0051481	negative regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0051481	negative regulation of cy tosolic calcium ion conce ntration	IBA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IDA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IDA	biological_process
GO:0051584	regulation of dopamine up take involved in synaptic transmission	IEA	biological_process
GO:0051584	regulation of dopamine up take involved in synaptic transmission	IC	biological_process
GO:0051586	positive regulation of do pamine uptake involved in synaptic transmission	IEA	biological_process
GO:0051586	positive regulation of do pamine uptake involved in synaptic transmission	ISS	biological_process
GO:0051823	regulation of synapse str uctural plasticity	IEA	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IEA	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	ISS	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	NAS	biological_process
GO:0051967	negative regulation of sy naptic transmission, glut amatergic	IEA	biological_process
GO:0051967	negative regulation of sy naptic transmission, glut amatergic	ISS	biological_process
GO:0051967	negative regulation of sy naptic transmission, glut amatergic	IBA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IEA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	ISS	biological_process
GO:0060134	prepulse inhibition	IEA	biological_process
GO:0060134	prepulse inhibition	ISS	biological_process
GO:0060158	phospholipase C-activatin g dopamine receptor signa ling pathway	IEA	biological_process
GO:0060158	phospholipase C-activatin g dopamine receptor signa ling pathway	IGI	biological_process
GO:0060160	negative regulation of do pamine receptor signaling pathway	IEA	biological_process
GO:0060160	negative regulation of do pamine receptor signaling pathway	ISS	biological_process
GO:0060170	ciliary membrane	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0090325	regulation of locomotion involved in locomotory be havior	IEA	biological_process
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:1900168	positive regulation of gl ial cell-derived neurotro phic factor secretion	IDA	biological_process
GO:1900273	positive regulation of lo ng-term synaptic potentia tion	IEA	biological_process
GO:1901386	negative regulation of vo ltage-gated calcium chann el activity	IEA	biological_process
GO:1901386	negative regulation of vo ltage-gated calcium chann el activity	IDA	biological_process
GO:0004935	adrenergic receptor activ ity	IBA	molecular_function
GO:0071880	adenylate cyclase-activat ing adrenergic receptor s ignaling pathway	IBA	biological_process
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001591	dopamine neurotransmitter receptor activity, coupl ed via Gi/Go	IDA	molecular_function
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001963	synaptic transmission, do paminergic	IBA	biological_process
GO:0001975	response to amphetamine	ISS	biological_process
GO:0001976	neurological system proce ss involved in regulation of systemic arterial blo od pressure	ISS	biological_process
GO:0002027	regulation of heart rate	ISS	biological_process
GO:0002028	regulation of sodium ion transport	ISS	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	ISS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006874	cellular calcium ion home ostasis	IC	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IDA	biological_process
GO:0007194	negative regulation of ad enylate cyclase activity	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007195	adenylate cyclase-inhibit ing dopamine receptor sig naling pathway	IDA	biological_process
GO:0007270	neuron-neuron synaptic tr ansmission	ISS	biological_process
GO:0007409	axonogenesis	ISS	biological_process
GO:0007416	synapse assembly	ISS	biological_process
GO:0007608	sensory perception of sme ll	ISS	biological_process
GO:0007626	locomotory behavior	ISS	biological_process
GO:0007628	adult walking behavior	ISS	biological_process
GO:0008104	protein localization	ISS	biological_process
GO:0008144	drug binding	IDA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	ISS	biological_process
GO:0008306	associative learning	ISS	biological_process
GO:0008542	visual learning	ISS	biological_process
GO:0009416	response to light stimulu s	ISS	biological_process
GO:0009636	response to toxic substan ce	IBA	biological_process
GO:0014059	regulation of dopamine se cretion	IBA	biological_process
GO:0015459	potassium channel regulat or activity	NAS	molecular_function
GO:0021853	cerebral cortex GABAergic interneuron migration	ISS	biological_process
GO:0021984	adenohypophysis developme nt	ISS	biological_process
GO:0030336	negative regulation of ce ll migration	ISS	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0030432	peristalsis	ISS	biological_process
GO:0030672	synaptic vesicle membrane	IBA	cellular_component
GO:0030814	regulation of cAMP metabo lic process	IDA	biological_process
GO:0032228	regulation of synaptic tr ansmission, GABAergic	ISS	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0034776	response to histamine	IDA	biological_process
GO:0035240	dopamine binding	IBA	molecular_function
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0042220	response to cocaine	ISS	biological_process
GO:0042417	dopamine metabolic proces s	IC	biological_process
GO:0042493	response to drug	ISS	biological_process
GO:0042493	response to drug	IBA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043266	regulation of potassium i on transport	ISS	biological_process
GO:0043266	regulation of potassium i on transport	IBA	biological_process
GO:0043278	response to morphine	ISS	biological_process
GO:0045776	negative regulation of bl ood pressure	ISS	biological_process
GO:0046488	phosphatidylinositol meta bolic process	ISS	biological_process
GO:0048148	behavioral response to co caine	ISS	biological_process
GO:0048148	behavioral response to co caine	IBA	biological_process
GO:0048149	behavioral response to et hanol	ISS	biological_process
GO:0048149	behavioral response to et hanol	IBA	biological_process
GO:0048169	regulation of long-term n euronal synaptic plastici ty	ISS	biological_process
GO:0048755	branching morphogenesis o f a nerve	ISS	biological_process
GO:0050482	arachidonic acid secretio n	IDA	biological_process
GO:0050709	negative regulation of pr otein secretion	IDA	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	ISS	biological_process
GO:0051481	negative regulation of cy tosolic calcium ion conce ntration	IBA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IDA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IDA	biological_process
GO:0051584	regulation of dopamine up take involved in synaptic transmission	IC	biological_process
GO:0051586	positive regulation of do pamine uptake involved in synaptic transmission	ISS	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	ISS	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	NAS	biological_process
GO:0051967	negative regulation of sy naptic transmission, glut amatergic	ISS	biological_process
GO:0051967	negative regulation of sy naptic transmission, glut amatergic	IBA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	ISS	biological_process
GO:0060134	prepulse inhibition	ISS	biological_process
GO:0060158	phospholipase C-activatin g dopamine receptor signa ling pathway	IGI	biological_process
GO:0060160	negative regulation of do pamine receptor signaling pathway	ISS	biological_process
GO:0060170	ciliary membrane	IDA	cellular_component
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:1900168	positive regulation of gl ial cell-derived neurotro phic factor secretion	IDA	biological_process
GO:1901386	negative regulation of vo ltage-gated calcium chann el activity	IDA	biological_process
GO:0004935	adrenergic receptor activ ity	IBA	molecular_function
GO:0071880	adenylate cyclase-activat ing adrenergic receptor s ignaling pathway	IBA	biological_process

KEGG pathways

hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04024  cAMP signaling pathway
hsa05034  Alcoholism
hsa04540  Gap junction
hsa05012  Parkinson's disease
hsa04728  Dopaminergic synapse
hsa05030  Cocaine addiction

Diseases

Associated diseases	References
Anovulation	PMID: 7962432
Attention-deficit hyperactivity disorder (ADHD)	PMID: 15457500
Autism	PMID: 19997080
Bipolar disorder	PMID: 11992560
Cancer	PMID: 12712467
Depression	PMID: 18501970
Diabetes	PMID: 11093282
Dyslexia	PMID: 14505070
Endometriosis	PMID: 25955176
Ovarian hyperstimulation syndrome (OHSS)	PMID: 21646367
Mood disorders	PMID: 10402492
Obesity	PMID: 19282821
Panic disorder	PMID: 12967601
Parkinson's disease	PMID: 12428723
Personality disorders	PMID: 12898574
Polycystic ovary syndrome (PCOS)	PMID: 21646367
Psychiatric disorders	PMID: 15542731
Endometriosis associated infertility	INFBASE23260856
Endometriosis	INFBASE23260856
Schizoaffective disorder	PMID: 17455212
Schizophrenia	PMID: 15140279
Stress disorder	PMID: 10088049
Tardive dyskinesia	PMID: 16160620
Tourette syndrome	PMID: 15094788

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23260856	Endometrio sis	Polymorphism 1 occurs in nucleotide 3420 (cytosine to thymine, 313 histidine), and polymorphism 2 occurs in nucleotide 3438 (cytosine to thymine, 319 proline)	Brazil	107 women with infertility cau sed by peritone al endometriosi s or patients e nrolled for tub al ligation.	Female infertility	VEGF D2 VEGFR-2	Show abstract