Endometriosis Knowledgebase

Search Result

Gene id

1844

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DUSP2 Gene UCSC Ensembl

Aliases

PAC-1, PAC1

Gene name

dual specificity phosphatase 2

Alternate names

dual specificity protein phosphatase 2, dual specificity protein phosphatase PAC-1, serine/threonine specific protein phosphatase,

Gene location

2q11.2 (96145467: 96143165) Exons: 4 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1 and ERK2, is predominantly expressed in hematopoietic tissues, and is localized in the nucleus. [provided by RefSeq, Jul 2008]

OMIM

603068

Protein Summary

Protein general information

Q05923

Name: Dual specificity protein phosphatase 2 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase PAC 1)

Length: 314 Mass: 34,400

Tissue specificity: Expressed in hematopoietic tissues.

Sequence

MGLEAARELECAALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACLLPDRA
LRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGFDGFQGCCPDLCSEAPAPA
LPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVE
DNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSF
MGQLLQFETQVLCH

Structural information

Protein Domains	Rhodanese. (23-144) Tyrosine-protein (237-302)
Interpro:	IPR000340 IPR024950 IPR008343 IPR029021 IPR001763 IPR016130 IPR003595 IPR000387 IPR020422
Prosite:	PS50206 PS00383 PS50056 PS50054
Pfam:	PF00782 PF00581
CDD:	cd00127
PDB:	1M3G
PDBsum:	1M3G
MINT:	8214530
STRING:	ENSP00000288943;

Other Databases

GeneCards: DUSP2; Malacards: DUSP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000188	inactivation of MAPK acti vity	TAS	biological_process
GO:0001706	endoderm formation	IBA	biological_process
GO:0004725	protein tyrosine phosphat ase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0006470	protein dephosphorylation	TAS	biological_process
GO:0008330	protein tyrosine/threonin e phosphatase activity	TAS	molecular_function
GO:0017017	MAP kinase tyrosine/serin e/threonine phosphatase a ctivity	IEA	molecular_function
GO:0035335	peptidyl-tyrosine dephosp horylation	IEA	biological_process
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular_function
GO:0000188	inactivation of MAPK acti vity	TAS	biological_process
GO:0001706	endoderm formation	IBA	biological_process
GO:0004721	phosphoprotein phosphatas e activity	IEA	molecular_function
GO:0004721	phosphoprotein phosphatas e activity	IEA	molecular_function
GO:0004721	phosphoprotein phosphatas e activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0006470	protein dephosphorylation	TAS	biological_process
GO:0008138	protein tyrosine/serine/t hreonine phosphatase acti vity	IEA	molecular_function
GO:0008330	protein tyrosine/threonin e phosphatase activity	TAS	molecular_function
GO:0016311	dephosphorylation	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0016791	phosphatase activity	IEA	molecular_function
GO:0017017	MAP kinase tyrosine/serin e/threonine phosphatase a ctivity	IEA	molecular_function
GO:0035335	peptidyl-tyrosine dephosp horylation	IEA	biological_process
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular_function
GO:0000188	inactivation of MAPK acti vity	TAS	biological_process
GO:0001706	endoderm formation	IBA	biological_process
GO:0004725	protein tyrosine phosphat ase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0006470	protein dephosphorylation	TAS	biological_process
GO:0008330	protein tyrosine/threonin e phosphatase activity	TAS	molecular_function

KEGG pathways

hsa04010 MAPK signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 21984126
Endometriosis	INFBASE21984126

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21984126	Endometrio sis					COX-2 MAPK HIF-1? DUSP2	Show abstract