Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1906
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol EDN1   Gene   UCSC   Ensembl
Aliases ARCND3, ET1, HDLCQ7, PPET1, QME
Gene name endothelin 1
Alternate names endothelin-1, preproendothelin-1,
Gene location 6p24.1 (12256463: 12297193)     Exons: 9     NC_000006.12
Gene summary(Entrez) This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]
OMIM 131240

SNPs

rs5370

Strand:    Allele origin: G(germline)/T(germline)  Allele change: G/T   Mutation type: snp

CM000668.2   g.12296022G>T
NC_000006.11   g.12296255G>T
NC_000006.12   g.12296022G>T
NG_016196.1   g.10727G>T
NM_001168319.1   c.591G>T
NM_001955.4   c.594G>T
NP_001161791.1   p.Lys197Asn
NP_001946.3   p.Lys198Asn
XP_011512632.1   p.Lys198Asn
XP_011512633.1   p.Lys198Asn
XP_011512634.1   p.Lys197Asn
XP_016865820.1   p.Lys198Asn
XR_241977.1   n.971C>A
Clinical Significance: other

Protein Summary

Protein general information P05305  

Name: Endothelin 1 (Preproendothelin 1) (PPET1) [Cleaved into: Endothelin 1 (ET 1); Big endothelin 1]

Length: 212  Mass: 24,425

Tissue specificity: Expressed in lung, placental stem villi vessels and in cultured placental vascular smooth muscle cells. {ECO

Sequence MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVN
TPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSK
LGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
Structural information
Interpro:  IPR020475 IPR019764 IPR001928
Prosite:   PS00270

Pfam:  
PF00322

PDB:  
1EDN 1EDP 1T7H 1V6R 5GLH
PDBsum:   1EDN 1EDP 1T7H 1V6R 5GLH
MINT:   1387120
STRING:   ENSP00000368683;
Other Databases GeneCards:  EDN1;  Malacards:  EDN1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0001516 prostaglandin biosyntheti
c process
IDA biological_process
GO:0001569 branching involved in blo
od vessel morphogenesis
IEA biological_process
GO:0001701 in utero embryonic develo
pment
IEA biological_process
GO:0001821 histamine secretion
IEA biological_process
GO:0003100 regulation of systemic ar
terial blood pressure by
endothelin
IDA biological_process
GO:0005125 cytokine activity
IDA molecular_function
GO:0005179 hormone activity
IDA molecular_function
GO:0005179 hormone activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0006885 regulation of pH
IEA biological_process
GO:0007166 cell surface receptor sig
naling pathway
IDA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IDA biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IDA biological_process
GO:0007205 protein kinase C-activati
ng G-protein coupled rece
ptor signaling pathway
IEA biological_process
GO:0007267 cell-cell signaling
IDA biological_process
GO:0007507 heart development
IEA biological_process
GO:0007585 respiratory gaseous excha
nge
IEA biological_process
GO:0007589 body fluid secretion
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0009953 dorsal/ventral pattern fo
rmation
IEA biological_process
GO:0010193 response to ozone
IEA biological_process
GO:0010259 multicellular organism ag
ing
IEA biological_process
GO:0010460 positive regulation of he
art rate
IDA biological_process
GO:0010595 positive regulation of en
dothelial cell migration
TAS biological_process
GO:0010613 positive regulation of ca
rdiac muscle hypertrophy
IDA biological_process
GO:0010870 positive regulation of re
ceptor biosynthetic proce
ss
IDA biological_process
GO:0014032 neural crest cell develop
ment
IEA biological_process
GO:0014065 phosphatidylinositol 3-ki
nase signaling
IDA biological_process
GO:0014823 response to activity
IEA biological_process
GO:0014824 artery smooth muscle cont
raction
TAS biological_process
GO:0014824 artery smooth muscle cont
raction
IDA biological_process
GO:0014826 vein smooth muscle contra
ction
IDA biological_process
GO:0015758 glucose transport
IEA biological_process
GO:0016049 cell growth
IEA biological_process
GO:0019229 regulation of vasoconstri
ction
IEA biological_process
GO:0019233 sensory perception of pai
n
IEA biological_process
GO:0019722 calcium-mediated signalin
g
IDA biological_process
GO:0019722 calcium-mediated signalin
g
IDA biological_process
GO:0030072 peptide hormone secretion
IDA biological_process
GO:0030185 nitric oxide transport
IDA biological_process
GO:0030195 negative regulation of bl
ood coagulation
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030818 negative regulation of cA
MP biosynthetic process
IEA biological_process
GO:0031583 phospholipase D-activatin
g G-protein coupled recep
tor signaling pathway
IEA biological_process
GO:0031707 endothelin A receptor bin
ding
IDA molecular_function
GO:0031708 endothelin B receptor bin
ding
IDA molecular_function
GO:0031708 endothelin B receptor bin
ding
IPI molecular_function
GO:0032269 negative regulation of ce
llular protein metabolic
process
IDA biological_process
GO:0032308 positive regulation of pr
ostaglandin secretion
IEA biological_process
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0033093 Weibel-Palade body
IEA cellular_component
GO:0033574 response to testosterone
IEA biological_process
GO:0034392 negative regulation of sm
ooth muscle cell apoptoti
c process
IEA biological_process
GO:0034696 response to prostaglandin
F
IEA biological_process
GO:0035094 response to nicotine
IEA biological_process
GO:0035690 cellular response to drug
IEA biological_process
GO:0035810 positive regulation of ur
ine volume
IEA biological_process
GO:0035815 positive regulation of re
nal sodium excretion
IEA biological_process
GO:0035994 response to muscle stretc
h
IEA biological_process
GO:0042045 epithelial fluid transpor
t
IEA biological_process
GO:0042310 vasoconstriction
IDA biological_process
GO:0042310 vasoconstriction
IDA biological_process
GO:0042313 protein kinase C deactiva
tion
IDA biological_process
GO:0042474 middle ear morphogenesis
IEA biological_process
GO:0042482 positive regulation of od
ontogenesis
IEA biological_process
GO:0042554 superoxide anion generati
on
IEA biological_process
GO:0043179 rhythmic excitation
IEA biological_process
GO:0043200 response to amino acid
IEA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043507 positive regulation of JU
N kinase activity
IDA biological_process
GO:0044321 response to leptin
IEA biological_process
GO:0045178 basal part of cell
IEA cellular_component
GO:0045321 leukocyte activation
TAS biological_process
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
TAS biological_process
GO:0045793 positive regulation of ce
ll size
IDA biological_process
GO:0045840 positive regulation of mi
totic nuclear division
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IEA biological_process
GO:0045987 positive regulation of sm
ooth muscle contraction
IEA biological_process
GO:0046887 positive regulation of ho
rmone secretion
IDA biological_process
GO:0046888 negative regulation of ho
rmone secretion
IEA biological_process
GO:0048016 inositol phosphate-mediat
ed signaling
IDA biological_process
GO:0048237 rough endoplasmic reticul
um lumen
IEA cellular_component
GO:0048661 positive regulation of sm
ooth muscle cell prolifer
ation
IDA biological_process
GO:0051216 cartilage development
IEA biological_process
GO:0051482 positive regulation of cy
tosolic calcium ion conce
ntration involved in phos
pholipase C-activating G-
protein coupled signaling
pathway
IEA biological_process
GO:0051771 negative regulation of ni
tric-oxide synthase biosy
nthetic process
IDA biological_process
GO:0051899 membrane depolarization
IEA biological_process
GO:0051930 regulation of sensory per
ception of pain
IEA biological_process
GO:0060137 maternal process involved
in parturition
IEA biological_process
GO:0060298 positive regulation of sa
rcomere organization
IMP biological_process
GO:0060585 positive regulation of pr
ostaglandin-endoperoxide
synthase activity
IMP biological_process
GO:0070101 positive regulation of ch
emokine-mediated signalin
g pathway
IC biological_process
GO:0071277 cellular response to calc
ium ion
IEA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IEA biological_process
GO:0071347 cellular response to inte
rleukin-1
IEA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IEA biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
IEA biological_process
GO:0071385 cellular response to gluc
ocorticoid stimulus
IEA biological_process
GO:0071389 cellular response to mine
ralocorticoid stimulus
IEA biological_process
GO:0071398 cellular response to fatt
y acid
IEA biological_process
GO:0071456 cellular response to hypo
xia
IEA biological_process
GO:0071548 response to dexamethasone
IEA biological_process
GO:0071560 cellular response to tran
sforming growth factor be
ta stimulus
IEA biological_process
GO:1902074 response to salt
IEA biological_process
GO:0030593 neutrophil chemotaxis
IDA biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0001501 skeletal system developme
nt
IEA biological_process
GO:0001516 prostaglandin biosyntheti
c process
IDA biological_process
GO:0001569 branching involved in blo
od vessel morphogenesis
IEA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0001701 in utero embryonic develo
pment
IEA biological_process
GO:0001821 histamine secretion
IEA biological_process
GO:0003100 regulation of systemic ar
terial blood pressure by
endothelin
IDA biological_process
GO:0005102 receptor binding
IEA molecular_function
GO:0005125 cytokine activity
IDA molecular_function
GO:0005179 hormone activity
IDA molecular_function
GO:0005179 hormone activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0006885 regulation of pH
IEA biological_process
GO:0007166 cell surface receptor sig
naling pathway
IDA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IDA biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IEA biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IDA biological_process
GO:0007205 protein kinase C-activati
ng G-protein coupled rece
ptor signaling pathway
IEA biological_process
GO:0007267 cell-cell signaling
IDA biological_process
GO:0007507 heart development
IEA biological_process
GO:0007585 respiratory gaseous excha
nge
IEA biological_process
GO:0007589 body fluid secretion
IEA biological_process
GO:0008217 regulation of blood press
ure
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0009953 dorsal/ventral pattern fo
rmation
IEA biological_process
GO:0010193 response to ozone
IEA biological_process
GO:0010259 multicellular organism ag
ing
IEA biological_process
GO:0010460 positive regulation of he
art rate
IDA biological_process
GO:0010595 positive regulation of en
dothelial cell migration
TAS biological_process
GO:0010613 positive regulation of ca
rdiac muscle hypertrophy
IDA biological_process
GO:0010870 positive regulation of re
ceptor biosynthetic proce
ss
IDA biological_process
GO:0014032 neural crest cell develop
ment
IEA biological_process
GO:0014065 phosphatidylinositol 3-ki
nase signaling
IDA biological_process
GO:0014823 response to activity
IEA biological_process
GO:0014824 artery smooth muscle cont
raction
IEA biological_process
GO:0014824 artery smooth muscle cont
raction
TAS biological_process
GO:0014824 artery smooth muscle cont
raction
IDA biological_process
GO:0014826 vein smooth muscle contra
ction
IDA biological_process
GO:0015758 glucose transport
IEA biological_process
GO:0016049 cell growth
IEA biological_process
GO:0019229 regulation of vasoconstri
ction
IEA biological_process
GO:0019233 sensory perception of pai
n
IEA biological_process
GO:0019722 calcium-mediated signalin
g
IDA biological_process
GO:0019722 calcium-mediated signalin
g
IDA biological_process
GO:0030072 peptide hormone secretion
IDA biological_process
GO:0030185 nitric oxide transport
IDA biological_process
GO:0030195 negative regulation of bl
ood coagulation
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030818 negative regulation of cA
MP biosynthetic process
IEA biological_process
GO:0031583 phospholipase D-activatin
g G-protein coupled recep
tor signaling pathway
IEA biological_process
GO:0031707 endothelin A receptor bin
ding
IEA molecular_function
GO:0031707 endothelin A receptor bin
ding
IDA molecular_function
GO:0031708 endothelin B receptor bin
ding
IEA molecular_function
GO:0031708 endothelin B receptor bin
ding
IDA molecular_function
GO:0031708 endothelin B receptor bin
ding
IPI molecular_function
GO:0032269 negative regulation of ce
llular protein metabolic
process
IDA biological_process
GO:0032308 positive regulation of pr
ostaglandin secretion
IEA biological_process
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0033093 Weibel-Palade body
IEA cellular_component
GO:0033574 response to testosterone
IEA biological_process
GO:0034392 negative regulation of sm
ooth muscle cell apoptoti
c process
IEA biological_process
GO:0034696 response to prostaglandin
F
IEA biological_process
GO:0035094 response to nicotine
IEA biological_process
GO:0035556 intracellular signal tran
sduction
IEA biological_process
GO:0035690 cellular response to drug
IEA biological_process
GO:0035810 positive regulation of ur
ine volume
IEA biological_process
GO:0035815 positive regulation of re
nal sodium excretion
IEA biological_process
GO:0035994 response to muscle stretc
h
IEA biological_process
GO:0042045 epithelial fluid transpor
t
IEA biological_process
GO:0042310 vasoconstriction
IEA biological_process
GO:0042310 vasoconstriction
IEA biological_process
GO:0042310 vasoconstriction
IDA biological_process
GO:0042310 vasoconstriction
IDA biological_process
GO:0042313 protein kinase C deactiva
tion
IDA biological_process
GO:0042474 middle ear morphogenesis
IEA biological_process
GO:0042482 positive regulation of od
ontogenesis
IEA biological_process
GO:0042493 response to drug
IEA biological_process
GO:0042554 superoxide anion generati
on
IEA biological_process
GO:0043179 rhythmic excitation
IEA biological_process
GO:0043200 response to amino acid
IEA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043507 positive regulation of JU
N kinase activity
IDA biological_process
GO:0044321 response to leptin
IEA biological_process
GO:0045178 basal part of cell
IEA cellular_component
GO:0045321 leukocyte activation
TAS biological_process
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
TAS biological_process
GO:0045793 positive regulation of ce
ll size
IDA biological_process
GO:0045840 positive regulation of mi
totic nuclear division
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IEA biological_process
GO:0045987 positive regulation of sm
ooth muscle contraction
IEA biological_process
GO:0046887 positive regulation of ho
rmone secretion
IDA biological_process
GO:0046888 negative regulation of ho
rmone secretion
IEA biological_process
GO:0048016 inositol phosphate-mediat
ed signaling
IDA biological_process
GO:0048237 rough endoplasmic reticul
um lumen
IEA cellular_component
GO:0048514 blood vessel morphogenesi
s
IEA biological_process
GO:0048661 positive regulation of sm
ooth muscle cell prolifer
ation
IDA biological_process
GO:0050880 regulation of blood vesse
l size
IEA biological_process
GO:0051216 cartilage development
IEA biological_process
GO:0051482 positive regulation of cy
tosolic calcium ion conce
ntration involved in phos
pholipase C-activating G-
protein coupled signaling
pathway
IEA biological_process
GO:0051771 negative regulation of ni
tric-oxide synthase biosy
nthetic process
IDA biological_process
GO:0051899 membrane depolarization
IEA biological_process
GO:0051930 regulation of sensory per
ception of pain
IEA biological_process
GO:0060137 maternal process involved
in parturition
IEA biological_process
GO:0060298 positive regulation of sa
rcomere organization
IMP biological_process
GO:0060585 positive regulation of pr
ostaglandin-endoperoxide
synthase activity
IMP biological_process
GO:0070101 positive regulation of ch
emokine-mediated signalin
g pathway
IC biological_process
GO:0071277 cellular response to calc
ium ion
IEA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IEA biological_process
GO:0071347 cellular response to inte
rleukin-1
IEA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IEA biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
IEA biological_process
GO:0071385 cellular response to gluc
ocorticoid stimulus
IEA biological_process
GO:0071389 cellular response to mine
ralocorticoid stimulus
IEA biological_process
GO:0071398 cellular response to fatt
y acid
IEA biological_process
GO:0071456 cellular response to hypo
xia
IEA biological_process
GO:0071548 response to dexamethasone
IEA biological_process
GO:0071559 response to transforming
growth factor beta
IEA biological_process
GO:0071560 cellular response to tran
sforming growth factor be
ta stimulus
IEA biological_process
GO:1902074 response to salt
IEA biological_process
GO:0030593 neutrophil chemotaxis
IDA biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0001516 prostaglandin biosyntheti
c process
IDA biological_process
GO:0003100 regulation of systemic ar
terial blood pressure by
endothelin
IDA biological_process
GO:0005125 cytokine activity
IDA molecular_function
GO:0005179 hormone activity
IDA molecular_function
GO:0005179 hormone activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0007166 cell surface receptor sig
naling pathway
IDA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IDA biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IDA biological_process
GO:0007267 cell-cell signaling
IDA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0010460 positive regulation of he
art rate
IDA biological_process
GO:0010595 positive regulation of en
dothelial cell migration
TAS biological_process
GO:0010613 positive regulation of ca
rdiac muscle hypertrophy
IDA biological_process
GO:0010870 positive regulation of re
ceptor biosynthetic proce
ss
IDA biological_process
GO:0014065 phosphatidylinositol 3-ki
nase signaling
IDA biological_process
GO:0014824 artery smooth muscle cont
raction
TAS biological_process
GO:0014824 artery smooth muscle cont
raction
IDA biological_process
GO:0014826 vein smooth muscle contra
ction
IDA biological_process
GO:0019722 calcium-mediated signalin
g
IDA biological_process
GO:0019722 calcium-mediated signalin
g
IDA biological_process
GO:0030072 peptide hormone secretion
IDA biological_process
GO:0030185 nitric oxide transport
IDA biological_process
GO:0030195 negative regulation of bl
ood coagulation
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0031707 endothelin A receptor bin
ding
IDA molecular_function
GO:0031708 endothelin B receptor bin
ding
IDA molecular_function
GO:0031708 endothelin B receptor bin
ding
IPI molecular_function
GO:0032269 negative regulation of ce
llular protein metabolic
process
IDA biological_process
GO:0042310 vasoconstriction
IDA biological_process
GO:0042310 vasoconstriction
IDA biological_process
GO:0042313 protein kinase C deactiva
tion
IDA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043507 positive regulation of JU
N kinase activity
IDA biological_process
GO:0045321 leukocyte activation
TAS biological_process
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
TAS biological_process
GO:0045793 positive regulation of ce
ll size
IDA biological_process
GO:0045840 positive regulation of mi
totic nuclear division
IDA biological_process
GO:0046887 positive regulation of ho
rmone secretion
IDA biological_process
GO:0048016 inositol phosphate-mediat
ed signaling
IDA biological_process
GO:0048661 positive regulation of sm
ooth muscle cell prolifer
ation
IDA biological_process
GO:0051771 negative regulation of ni
tric-oxide synthase biosy
nthetic process
IDA biological_process
GO:0060298 positive regulation of sa
rcomere organization
IMP biological_process
GO:0060585 positive regulation of pr
ostaglandin-endoperoxide
synthase activity
IMP biological_process
GO:0070101 positive regulation of ch
emokine-mediated signalin
g pathway
IC biological_process
GO:0030593 neutrophil chemotaxis
IDA biological_process

KEGG pathways

hsa05418  Fluid shear stress and atherosclerosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04668  TNF signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04916  Melanogenesis

Diseases

Associated diseases References
Alzheimer's disease PMID: 19141999
Asthma PMID: 11831453
Atherosclerosis PMID: 12446192
Atopy PMID: 10200023
Cancer PMID: 19692168
Chronic obstructive pulmonary disease (COPD) PMID: 19640695
Cystic fibrosis PMID: 20028935
Diabetes PMID: 16526196
Diabetic nephropathy PMID: 17345061
Diabetic retinopathy PMID: 12724690
Endometriosis PMID: 8194621
Female infertility PMID: 9130894
Glaucoma PMID: 9493554
Glomerulonephritis PMID: 19420105
Hypoplastic left heart syndrome PMID: 18603063
Kidney disease PMID: 14514737
Metabolic syndrome PMID: 19056482
Migraine disorders PMID: 19661472
Obesity PMID: 18580062
Ovarian hyperstimulation syndrome (OHSS) PMID: 7789582
Periodontitis PMID: 11210078
Polycystic kidney disease PMID: 16943682
Polycystic ovary syndrome (PCOS) PMID: 22281885
Preeclampsia PMID: 19730395
Psoriasis PMID: 12077518
Endometriosis associated infertility INFBASE8194621
Endometriosis INFBASE8194621
Retinopathy PMID: 11399938
Rheumatoid arthritis PMID: 18663623
Sickle cell anemia PMID: 16956834
Sudden infant death syndrome (SIDS) PMID: 15240857
Vitiligo PMID: 19416273

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
8194621 Endometrio
sis


Female infertility Endothelin-1
Show abstract
19626996 Endometrio
sis

61 (48 cases of
endometriosis
(EM), control s
amples were eut
opic endometriu
m from 13 cases
of cervical in
traepithelial n
eoplasia (CIN))
Female infertility ET(A)R
ET-1
Show abstract