Endometriosis Knowledgebase

Search Result

Gene id

1942

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

EFNA1 Gene UCSC Ensembl

Aliases

B61, ECKLG, EFL1, EPLG1, LERK-1, LERK1, TNFAIP4

Gene name

ephrin A1

Alternate names

ephrin-A1, TNF alpha-induced protein 4, eph-related receptor tyrosine kinase ligand 1, immediate early response protein B61, ligand of eph-related kinase 1, tumor necrosis factor, alpha-induced protein 4,

Gene location

1q22 (155127872: 155134909) Exons: 5 NC_000001.11

Gene summary(Entrez)

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008]

OMIM

191164

Protein Summary

Protein general information

P20827

Name: Ephrin A1 (EPH related receptor tyrosine kinase ligand 1) (LERK 1) (Immediate early response protein B61) (Tumor necrosis factor alpha induced protein 4) (TNF alpha induced protein 4) [Cleaved into: Ephrin A1, secreted form]

Length: 205 Mass: 23,787

Tissue specificity: Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level). {ECO

Sequence

MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHE
EYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGK
ITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP

Structural information

Protein Domains	Ephrin (19-151)
Interpro:	IPR008972 IPR031328 IPR034252 IPR019765 IPR001799
Prosite:	PS01299 PS51551
Pfam:	PF00812
CDD:	cd10425
PDB:	3CZU 3HEI 3MBW
PDBsum:	3CZU 3HEI 3MBW
DIP:	98
MINT:	1393983
STRING:	ENSP00000357392;

Other Databases

GeneCards: EFNA1; Malacards: EFNA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001525	angiogenesis	IBA	biological_process
GO:0003180	aortic valve morphogenesi s	ISS	biological_process
GO:0003183	mitral valve morphogenesi s	ISS	biological_process
GO:0003199	endocardial cushion to me senchymal transition invo lved in heart valve forma tion	ISS	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007411	axon guidance	IBA	biological_process
GO:0010719	negative regulation of ep ithelial to mesenchymal t ransition	ISS	biological_process
GO:0014028	notochord formation	IEA	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0043535	regulation of blood vesse l endothelial cell migrat ion	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IEA	biological_process
GO:0046658	anchored component of pla sma membrane	IBA	cellular_component
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050770	regulation of axonogenesi s	IEA	biological_process
GO:0061002	negative regulation of de ndritic spine morphogenes is	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001525	angiogenesis	IBA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0003180	aortic valve morphogenesi s	IEA	biological_process
GO:0003180	aortic valve morphogenesi s	ISS	biological_process
GO:0003183	mitral valve morphogenesi s	IEA	biological_process
GO:0003183	mitral valve morphogenesi s	ISS	biological_process
GO:0003199	endocardial cushion to me senchymal transition invo lved in heart valve forma tion	IEA	biological_process
GO:0003199	endocardial cushion to me senchymal transition invo lved in heart valve forma tion	ISS	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007411	axon guidance	IBA	biological_process
GO:0010719	negative regulation of ep ithelial to mesenchymal t ransition	IEA	biological_process
GO:0010719	negative regulation of ep ithelial to mesenchymal t ransition	ISS	biological_process
GO:0014028	notochord formation	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016477	cell migration	IDA	biological_process
GO:0030182	neuron differentiation	IEA	biological_process
GO:0031225	anchored component of mem brane	IEA	cellular_component
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0043535	regulation of blood vesse l endothelial cell migrat ion	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IEA	biological_process
GO:0046658	anchored component of pla sma membrane	IEA	cellular_component
GO:0046658	anchored component of pla sma membrane	IBA	cellular_component
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0046875	ephrin receptor binding	TAS	molecular_function
GO:0048013	ephrin receptor signaling pathway	IEA	biological_process
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	IEA	biological_process
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050770	regulation of axonogenesi s	IEA	biological_process
GO:0061002	negative regulation of de ndritic spine morphogenes is	IEA	biological_process
GO:0061002	negative regulation of de ndritic spine morphogenes is	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0001525	angiogenesis	IBA	biological_process
GO:0003180	aortic valve morphogenesi s	ISS	biological_process
GO:0003183	mitral valve morphogenesi s	ISS	biological_process
GO:0003199	endocardial cushion to me senchymal transition invo lved in heart valve forma tion	ISS	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007411	axon guidance	IBA	biological_process
GO:0010719	negative regulation of ep ithelial to mesenchymal t ransition	ISS	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0033628	regulation of cell adhesi on mediated by integrin	IDA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0046658	anchored component of pla sma membrane	IBA	cellular_component
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0046875	ephrin receptor binding	TAS	molecular_function
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0061002	negative regulation of de ndritic spine morphogenes is	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance

Diseases

Associated diseases	References
Endometriosis	PMID: 26148093
Implantation failure	PMID: 12810542
Female infertility	INFBASE12810542
Implantation defects	INFBASE12810542
Endometriosis	INFBASE12810542

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12810542	Endometrio sis					IL-15 proline-rich protein B61 Dickkopf-1 glycodelin N-acetylglucosamine-6-O-sulfotransferase G0S2 protein purine nucleoside phosphorylase semaphorin E neuronal olfactomedin-related endoplasmic reticulum localized protein mRNA Sam68-like phospho	Show abstract