Endometriosis Knowledgebase

Search Result

Gene id

1950

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

EGF Gene UCSC Ensembl

Aliases

HOMG4, URG

Gene name

epidermal growth factor

Alternate names

pro-epidermal growth factor, beta-urogastrone,

Gene location

4q25 (109912882: 110013078) Exons: 26 NC_000004.12

Gene summary(Entrez)

This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]

OMIM

131530

Protein Summary

Protein general information

P01133

Name: Pro epidermal growth factor (EGF) [Cleaved into: Epidermal growth factor (Urogastrone)]

Length: 1207 Mass: 133,994

Tissue specificity: Expressed in kidney, salivary gland, cerebrum and prostate. {ECO

Sequence

MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRIDTEGTNYEQLVVDAGV
SVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGIITVTDMKGNNS
HILLSALKYPANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSN
SLICSCDYDGGSVHISKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTLGCKNTP
GSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQL
CVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENK
IYFAHTALKWIERANMDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSK
RRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNG
GCEHICKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVA
EIMVSDQDDCAPVGCSMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSE
CPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLS
LWGAHYYRTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGS
MQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ

Structural information

Protein Domains	EGF-like (314-355) EGF-like (356-396) ({ECO:0000255\|PROSITE-ProRule:PRU00076}-) EGF-like (397-437) EGF-like (435-477)
Interpro:	IPR011042 IPR001881 IPR013032 IPR000742 IPR000152 IPR018097 IPR009030 IPR000033 IPR016317
Prosite:	PS00010 PS00022 PS01186 PS50026 PS01187 PS51120
Pfam:	PF00008 PF07645 PF00058
PDB:	1IVO 1JL9 1NQL 1P9J 2KV4 3NJP
PDBsum:	1IVO 1JL9 1NQL 1P9J 2KV4 3NJP
DIP:	5767
MINT:	260489
STRING:	ENSP00000265171;

Other Databases

GeneCards: EGF; Malacards: EGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000186	activation of MAPKK activ ity	IEA	biological_process
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005154	epidermal growth factor r eceptor binding	TAS	molecular_function
GO:0005154	epidermal growth factor r eceptor binding	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IC	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007262	STAT protein import into nucleus	ISS	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0017147	Wnt-protein binding	IBA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0021940	positive regulation of ce rebellar granule cell pre cursor proliferation	IEA	biological_process
GO:0030297	transmembrane receptor pr otein tyrosine kinase act ivator activity	TAS	molecular_function
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0035413	positive regulation of ca tenin import into nucleus	IDA	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042813	Wnt-activated receptor ac tivity	IBA	molecular_function
GO:0043235	receptor complex	IBA	cellular_component
GO:0043388	positive regulation of DN A binding	ISS	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0044332	Wnt signaling pathway inv olved in dorsal/ventral a xis specification	IBA	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	TAS	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0051048	negative regulation of se cretion	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IBA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0090279	regulation of calcium ion import	IDA	biological_process
GO:0090370	negative regulation of ch olesterol efflux	IEA	biological_process
GO:1900127	positive regulation of hy aluronan biosynthetic pro cess	IDA	biological_process
GO:2000008	regulation of protein loc alization to cell surface	IDA	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IEA	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000186	activation of MAPKK activ ity	IEA	biological_process
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005154	epidermal growth factor r eceptor binding	IEA	molecular_function
GO:0005154	epidermal growth factor r eceptor binding	TAS	molecular_function
GO:0005154	epidermal growth factor r eceptor binding	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IC	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007262	STAT protein import into nucleus	IEA	biological_process
GO:0007262	STAT protein import into nucleus	ISS	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0017147	Wnt-protein binding	IBA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0021940	positive regulation of ce rebellar granule cell pre cursor proliferation	IEA	biological_process
GO:0030297	transmembrane receptor pr otein tyrosine kinase act ivator activity	TAS	molecular_function
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0035413	positive regulation of ca tenin import into nucleus	IDA	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042813	Wnt-activated receptor ac tivity	IBA	molecular_function
GO:0043235	receptor complex	IBA	cellular_component
GO:0043388	positive regulation of DN A binding	IEA	biological_process
GO:0043388	positive regulation of DN A binding	ISS	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0044332	Wnt signaling pathway inv olved in dorsal/ventral a xis specification	IBA	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	TAS	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0051048	negative regulation of se cretion	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IBA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0090279	regulation of calcium ion import	IDA	biological_process
GO:0090370	negative regulation of ch olesterol efflux	IEA	biological_process
GO:1900127	positive regulation of hy aluronan biosynthetic pro cess	IDA	biological_process
GO:2000008	regulation of protein loc alization to cell surface	IDA	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IEA	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005154	epidermal growth factor r eceptor binding	TAS	molecular_function
GO:0005154	epidermal growth factor r eceptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IC	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007262	STAT protein import into nucleus	ISS	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0017147	Wnt-protein binding	IBA	molecular_function
GO:0030297	transmembrane receptor pr otein tyrosine kinase act ivator activity	TAS	molecular_function
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0035413	positive regulation of ca tenin import into nucleus	IDA	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042813	Wnt-activated receptor ac tivity	IBA	molecular_function
GO:0043235	receptor complex	IBA	cellular_component
GO:0043388	positive regulation of DN A binding	ISS	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0044332	Wnt signaling pathway inv olved in dorsal/ventral a xis specification	IBA	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	TAS	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0051048	negative regulation of se cretion	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IBA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0090279	regulation of calcium ion import	IDA	biological_process
GO:1900127	positive regulation of hy aluronan biosynthetic pro cess	IDA	biological_process
GO:2000008	regulation of protein loc alization to cell surface	IDA	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
PTHR10740:SF4  EGF receptor signaling pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
PTHR11100:SF20  EGF receptor signaling pathway
hsa04510  Focal adhesion
hsa05224  Breast cancer
hsa04068  FoxO signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04144  Endocytosis
hsa05215  Prostate cancer
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa04072  Phospholipase D signaling pathway
PTHR11100:SF7  EGF receptor signaling pathway
hsa05218  Melanoma
hsa05212  Pancreatic cancer
hsa04012  ErbB signaling pathway
hsa05219  Bladder cancer
hsa05231  Choline metabolism in cancer
hsa05214  Glioma
hsa05213  Endometrial cancer
hsa04540  Gap junction
hsa05223  Non-small cell lung cancer
PTHR11100:SF18  EGF receptor signaling pathway
PTHR44717:SF1  EGF receptor signaling pathway
PTHR11100:SF20  EGF receptor signaling pathway
PTHR10740:SF3  EGF receptor signaling pathway
PTHR10740:SF12  EGF receptor signaling pathway
PTHR10740:SF1  EGF receptor signaling pathway
PTHR10740:SF11  EGF receptor signaling pathway

Diseases

Associated diseases	References
Adenomyosis	PMID: 12069392
Cardiovascular disease	PMID: 12009575
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Cryptorchidism	PMID: 12508124
Diabetes	PMID: 17479438
Endometriosis	PMID: 27128987
Gastric cancer	KEGG: H00018
Hypomagnesemia	KEGG: H01210, OMIM: 131530
Male infertility	PMID: 11379442
Oocyte maturation	PMID: 22532606
Periodontitis	PMID: 15081423
Polycystic ovary syndrome (PCOS)	PMID: 8654631
Preeclampsia	PMID: 19708171
Prostatic function	PMID: 1503528
Prostatitis	PMID: 1503528
Psoriasis	PMID: 17204151
Psychiatric disorders	PMID: 19086053
Endometriosis	INFBASE27128987
Endometriosis	INFBASE17578349
Respiratory distress syndrome	PMID: 19010984
Schizophrenia	PMID: 18583979

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27128987	Endometrio sis			94 (74 endometr iosis patients (stages I-II: 4 0; stages III-I V: 34) , 20 wom en without endo metriosis)	Female infertility		Show abstract
17578349	Endometrio sis			66 (35 women wi th advanced sta ge endometriosi s, 31 control w omen)		EGF FGF-2 PDGF-A	Show abstract