Endometriosis Knowledgebase

Search Result

Gene id

1978

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

EIF4EBP1 Gene UCSC Ensembl

Aliases

4E-BP1, 4EBP1, BP-1, PHAS-I

Gene name

eukaryotic translation initiation factor 4E binding protein 1

Alternate names

eukaryotic translation initiation factor 4E-binding protein 1, eIF4E-binding protein 1, phosphorylated heat- and acid-stable protein regulated by insulin 1,

Gene location

8p11.23 (38030501: 38060364) Exons: 3 NC_000008.11

Gene summary(Entrez)

This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq, Jul 2008]

OMIM

602223

Protein Summary

Protein general information

Q13541

Name: Eukaryotic translation initiation factor 4E binding protein 1 (4E BP1) (eIF4E binding protein 1) (Phosphorylated heat and acid stable protein regulated by insulin 1) (PHAS I)

Length: 118 Mass: 12,580

Sequence

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDL
PTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Structural information

Motifs	YXXXXLphi motif.(54-60) TOS motif.(114-118)
Interpro:	IPR008606
Pfam:	PF05456
PDB:	1EJ4 1WKW 2JGB 2JGC 2V8W 2V8X 2V8Y 3HXG 3HXI 3M93 3M94 3U7X 4UED 5BXV 5EKV
PDBsum:	1EJ4 1WKW 2JGB 2JGC 2V8W 2V8X 2V8Y 3HXG 3HXI 3M93 3M94 3U7X 4UED 5BXV 5EKV
DIP:	30944
MINT:	210160
STRING:	ENSP00000340691;

Other Databases

GeneCards: EIF4EBP1; Malacards: EIF4EBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	IMP	biological_process
GO:0002192	IRES-dependent translatio nal initiation	IEA	biological_process
GO:0002931	response to ischemia	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0008190	eukaryotic initiation fac tor 4E binding	IDA	molecular_function
GO:0008286	insulin receptor signalin g pathway	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030371	translation repressor act ivity	IDA	molecular_function
GO:0031333	negative regulation of pr otein complex assembly	IEA	biological_process
GO:0031929	TOR signaling	IDA	biological_process
GO:0031929	TOR signaling	IDA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0045471	response to ethanol	IEA	biological_process
GO:0045931	positive regulation of mi totic cell cycle	IMP	biological_process
GO:0045947	negative regulation of tr anslational initiation	IDA	biological_process
GO:0051721	protein phosphatase 2A bi nding	IEA	molecular_function
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IMP	biological_process
GO:0002192	IRES-dependent translatio nal initiation	IEA	biological_process
GO:0002931	response to ischemia	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006417	regulation of translation	IEA	biological_process
GO:0008190	eukaryotic initiation fac tor 4E binding	IEA	molecular_function
GO:0008190	eukaryotic initiation fac tor 4E binding	IEA	molecular_function
GO:0008190	eukaryotic initiation fac tor 4E binding	IDA	molecular_function
GO:0008286	insulin receptor signalin g pathway	IEA	biological_process
GO:0017148	negative regulation of tr anslation	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030371	translation repressor act ivity	IDA	molecular_function
GO:0031333	negative regulation of pr otein complex assembly	IEA	biological_process
GO:0031369	translation initiation fa ctor binding	IEA	molecular_function
GO:0031929	TOR signaling	IDA	biological_process
GO:0031929	TOR signaling	IDA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0045471	response to ethanol	IEA	biological_process
GO:0045931	positive regulation of mi totic cell cycle	IMP	biological_process
GO:0045947	negative regulation of tr anslational initiation	IEA	biological_process
GO:0045947	negative regulation of tr anslational initiation	IEA	biological_process
GO:0045947	negative regulation of tr anslational initiation	IDA	biological_process
GO:0051721	protein phosphatase 2A bi nding	IEA	molecular_function
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IMP	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0008190	eukaryotic initiation fac tor 4E binding	IDA	molecular_function
GO:0030371	translation repressor act ivity	IDA	molecular_function
GO:0031929	TOR signaling	IDA	biological_process
GO:0031929	TOR signaling	IDA	biological_process
GO:0045931	positive regulation of mi totic cell cycle	IMP	biological_process
GO:0045947	negative regulation of tr anslational initiation	IDA	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04066  HIF-1 signaling pathway
hsa04152  AMPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa04150  mTOR signaling pathway
hsa04211  Longevity regulating pathway
hsa05231  Choline metabolism in cancer
hsa05221  Acute myeloid leukemia
hsa03013  RNA transport

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19271249
Endometriosis	PMID: 19429661
Multiple system atrophy	PMID: 18442140
Endometriosis	INFBASE19429661

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19429661	Endometrio sis			81 (40 women wi th endometriosi s, 41 controls)		NF1 RHEB mTOR PTEN TSC1 TSC2 KRAS S6K1 TP53 EIF4E LKB1 PIK3CA BECN1 4EBP1 and AKT1	Show abstract