Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1994
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol ELAVL1   Gene   UCSC   Ensembl
Aliases ELAV1, HUR, Hua, MelG
Gene name ELAV like RNA binding protein 1
Alternate names ELAV-like protein 1, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R), Hu antigen R, embryonic lethal, abnormal vision, drosophila, homolog-like 1, hu-antigen R,
Gene location 19p13.2 (8005644: 7958572)     Exons: 7     NC_000019.10
Gene summary(Entrez) The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy. [provided by RefSeq, Sep 2012]
OMIM 603466

Protein Summary
Protein general information Q15717  

Name: ELAV like protein 1 (Hu antigen R) (HuR)

Length: 326  Mass: 36,092

Tissue specificity: Ubiquitous. Detected in brain, liver, thymus and muscle. {ECO

Sequence MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAE
RAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVA
FIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGV
DHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
AIASLNGYRLGDKILQVSFKTNKSHK
Structural information
Protein Domains
 RRM (20-98)
RRM (106-186)
RRM (244-322)
Interpro:  IPR006548 IPR002343 IPR000504
Prosite:   PS50102

Pfam:  		 PF00076

PDB:  		 3HI9 4ED5 4EGL 4FXV
PDBsum:   3HI9 4ED5 4EGL 4FXV

DIP:  		 31291
MINT:   5001300
STRING:   ENSP00000385269;
Other Databases GeneCards:  ELAVL1;  Malacards:  ELAVL1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000166 nucleotide binding
 IEA molecular_function
GO:0000398 mRNA splicing, via splice
osome
 TAS biological_process
GO:0003723 RNA binding
 IDA molecular_function
GO:0003723 RNA binding
 IDA molecular_function
GO:0003725 double-stranded RNA bindi
ng
 IDA molecular_function
GO:0003729 mRNA binding
 TAS molecular_function
GO:0003730 mRNA 3'-UTR binding
 ISS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0007275 multicellular organism de
velopment
 TAS biological_process
GO:0016020 membrane
 IDA cellular_component
GO:0017091 AU-rich element binding
 IDA molecular_function
GO:0017091 AU-rich element binding
 IDA molecular_function
GO:0019901 protein kinase binding
 IPI molecular_function
GO:0035925 mRNA 3'-UTR AU-rich regio
n binding
 IDA molecular_function
GO:0035925 mRNA 3'-UTR AU-rich regio
n binding
 IDA molecular_function
GO:0042803 protein homodimerization
activity
 IPI molecular_function
GO:0043488 regulation of mRNA stabil
ity
 TAS biological_process
GO:0044822 poly(A) RNA binding
 IDA molecular_function
GO:0044822 poly(A) RNA binding
 IDA molecular_function
GO:0045727 positive regulation of tr
anslation
 IDA biological_process
GO:0048255 mRNA stabilization
 IMP biological_process
GO:0048255 mRNA stabilization
 IDA biological_process
GO:0070935 3'-UTR-mediated mRNA stab
ilization
 IDA biological_process
GO:0070935 3'-UTR-mediated mRNA stab
ilization
 IMP biological_process
GO:2000036 regulation of stem cell p
opulation maintenance
 ISS biological_process
GO:0000166 nucleotide binding
 IEA molecular_function
GO:0000398 mRNA splicing, via splice
osome
 TAS biological_process
GO:0003676 nucleic acid binding
 IEA molecular_function
GO:0003723 RNA binding
 IEA molecular_function
GO:0003723 RNA binding
 IEA molecular_function
GO:0003723 RNA binding
 IDA molecular_function
GO:0003723 RNA binding
 IDA molecular_function
GO:0003725 double-stranded RNA bindi
ng
 IDA molecular_function
GO:0003729 mRNA binding
 TAS molecular_function
GO:0003730 mRNA 3'-UTR binding
 IEA molecular_function
GO:0003730 mRNA 3'-UTR binding
 ISS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0007275 multicellular organism de
velopment
 TAS biological_process
GO:0016020 membrane
 IDA cellular_component
GO:0017091 AU-rich element binding
 IDA molecular_function
GO:0017091 AU-rich element binding
 IDA molecular_function
GO:0019901 protein kinase binding
 IEA molecular_function
GO:0019901 protein kinase binding
 IPI molecular_function
GO:0035925 mRNA 3'-UTR AU-rich regio
n binding
 IDA molecular_function
GO:0035925 mRNA 3'-UTR AU-rich regio
n binding
 IDA molecular_function
GO:0042803 protein homodimerization
activity
 IPI molecular_function
GO:0043488 regulation of mRNA stabil
ity
 TAS biological_process
GO:0044822 poly(A) RNA binding
 IDA molecular_function
GO:0044822 poly(A) RNA binding
 IDA molecular_function
GO:0045727 positive regulation of tr
anslation
 IEA biological_process
GO:0045727 positive regulation of tr
anslation
 IDA biological_process
GO:0048255 mRNA stabilization
 IEA biological_process
GO:0048255 mRNA stabilization
 IMP biological_process
GO:0048255 mRNA stabilization
 IDA biological_process
GO:0070935 3'-UTR-mediated mRNA stab
ilization
 IDA biological_process
GO:0070935 3'-UTR-mediated mRNA stab
ilization
 IMP biological_process
GO:2000036 regulation of stem cell p
opulation maintenance
 IEA biological_process
GO:2000036 regulation of stem cell p
opulation maintenance
 ISS biological_process
GO:0000398 mRNA splicing, via splice
osome
 TAS biological_process
GO:0003723 RNA binding
 IDA molecular_function
GO:0003723 RNA binding
 IDA molecular_function
GO:0003725 double-stranded RNA bindi
ng
 IDA molecular_function
GO:0003729 mRNA binding
 TAS molecular_function
GO:0003730 mRNA 3'-UTR binding
 ISS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005829 cytosol
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0007275 multicellular organism de
velopment
 TAS biological_process
GO:0016020 membrane
 IDA cellular_component
GO:0017091 AU-rich element binding
 IDA molecular_function
GO:0017091 AU-rich element binding
 IDA molecular_function
GO:0019901 protein kinase binding
 IPI molecular_function
GO:0035925 mRNA 3'-UTR AU-rich regio
n binding
 IDA molecular_function
GO:0035925 mRNA 3'-UTR AU-rich regio
n binding
 IDA molecular_function
GO:0042803 protein homodimerization
activity
 IPI molecular_function
GO:0043488 regulation of mRNA stabil
ity
 TAS biological_process
GO:0044822 poly(A) RNA binding
 IDA molecular_function
GO:0044822 poly(A) RNA binding
 IDA molecular_function
GO:0045727 positive regulation of tr
anslation
 IDA biological_process
GO:0048255 mRNA stabilization
 IMP biological_process
GO:0048255 mRNA stabilization
 IDA biological_process
GO:0070935 3'-UTR-mediated mRNA stab
ilization
 IDA biological_process
GO:0070935 3'-UTR-mediated mRNA stab
ilization
 IMP biological_process
GO:2000036 regulation of stem cell p
opulation maintenance
 ISS biological_process

KEGG pathways

hsa04657  IL-17 signaling pathway
hsa04152  AMPK signaling pathway

Diseases

Associated diseases References
Endometriosis PMID: 20889954
Endometriosis INFBASE20889954

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
20889954 Endometrio
sis
39 (23 normal e
ndometrium, 16
ectopic endomet
rium)
 HuR
 Show abstract