Endometriosis Knowledgebase

Search Result

Gene id

2065

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ERBB3 Gene UCSC Ensembl

Aliases

ErbB-3, HER3, LCCS2, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3

Gene name

erb-b2 receptor tyrosine kinase 3

Alternate names

receptor tyrosine-protein kinase erbB-3, human epidermal growth factor receptor 3, proto-oncogene-like protein c-ErbB-3, tyrosine kinase-type cell surface receptor HER3, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3,

Gene location

12q13.2 (56080024: 56103506) Exons: 28 NC_000012.12

Gene summary(Entrez)

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

OMIM

190151

Protein Summary

Protein general information

P21860

Name: Receptor tyrosine protein kinase erbB 3 (EC 2.7.10.1) (Proto oncogene like protein c ErbB 3) (Tyrosine kinase type cell surface receptor HER3)

Length: 1342 Mass: 148,098

Tissue specificity: Epithelial tissues and brain.

Sequence

MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLS
FLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIE
KNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQ
CCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHK
IPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEIS
AGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSR
GGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKR
AMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGR
QSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYL
EEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRY
LVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSP
SSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPR
PRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYMNRQRDGGGPGGD
YAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT

Structural information

Protein Domains	Protein (709-966)
Interpro:	IPR006211 IPR006212 IPR032778 IPR009030 IPR011009 IPR032675 IPR000719 IPR000494 IPR001245 IPR016245
Prosite:	PS50011
Pfam:	PF00757 PF14843 PF07714 PF01030
PDB:	1M6B 2L9U 3KEX 3LMG 3P11 4LEO 4OTW 4P59 4RIW 4RIX 4RIY 5CUS
PDBsum:	1M6B 2L9U 3KEX 3LMG 3P11 4LEO 4OTW 4P59 4RIW 4RIX 4RIY 5CUS
DIP:	36441
MINT:	158484
STRING:	ENSP00000267101;

Other Databases

GeneCards: ERBB3; Malacards: ERBB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0003197	endocardial cushion devel opment	IEA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	ISS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007162	negative regulation of ce ll adhesion	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	ISS	biological_process
GO:0007422	peripheral nervous system development	ISS	biological_process
GO:0007507	heart development	ISS	biological_process
GO:0009968	negative regulation of si gnal transduction	IDA	biological_process
GO:0014037	Schwann cell differentiat ion	ISS	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	TAS	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016328	lateral plasma membrane	IEA	cellular_component
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	ISS	molecular_function
GO:0021545	cranial nerve development	ISS	biological_process
GO:0030296	protein tyrosine kinase a ctivator activity	IDA	molecular_function
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0042060	wound healing	NAS	biological_process
GO:0042127	regulation of cell prolif eration	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0043235	receptor complex	IDA	cellular_component
GO:0043235	receptor complex	ISS	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	ISS	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0051048	negative regulation of se cretion	IDA	biological_process
GO:0051402	neuron apoptotic process	IMP	biological_process
GO:0061098	positive regulation of pr otein tyrosine kinase act ivity	IMP	biological_process
GO:0070886	positive regulation of ca lcineurin-NFAT signaling cascade	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IMP	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0003197	endocardial cushion devel opment	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	ISS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007162	negative regulation of ce ll adhesion	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	ISS	biological_process
GO:0007422	peripheral nervous system development	IEA	biological_process
GO:0007422	peripheral nervous system development	ISS	biological_process
GO:0007507	heart development	ISS	biological_process
GO:0009968	negative regulation of si gnal transduction	IDA	biological_process
GO:0014037	Schwann cell differentiat ion	IEA	biological_process
GO:0014037	Schwann cell differentiat ion	ISS	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016328	lateral plasma membrane	IEA	cellular_component
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	ISS	molecular_function
GO:0021545	cranial nerve development	IEA	biological_process
GO:0021545	cranial nerve development	ISS	biological_process
GO:0030296	protein tyrosine kinase a ctivator activity	IDA	molecular_function
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0042060	wound healing	NAS	biological_process
GO:0042127	regulation of cell prolif eration	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0043235	receptor complex	IDA	cellular_component
GO:0043235	receptor complex	ISS	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	ISS	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0051048	negative regulation of se cretion	IDA	biological_process
GO:0051402	neuron apoptotic process	IMP	biological_process
GO:0061098	positive regulation of pr otein tyrosine kinase act ivity	IMP	biological_process
GO:0070886	positive regulation of ca lcineurin-NFAT signaling cascade	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IMP	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	ISS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007162	negative regulation of ce ll adhesion	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	ISS	biological_process
GO:0007422	peripheral nervous system development	ISS	biological_process
GO:0007507	heart development	ISS	biological_process
GO:0009968	negative regulation of si gnal transduction	IDA	biological_process
GO:0014037	Schwann cell differentiat ion	ISS	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IDA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	TAS	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	ISS	molecular_function
GO:0021545	cranial nerve development	ISS	biological_process
GO:0030296	protein tyrosine kinase a ctivator activity	IDA	molecular_function
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0042060	wound healing	NAS	biological_process
GO:0042127	regulation of cell prolif eration	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0043235	receptor complex	IDA	cellular_component
GO:0043235	receptor complex	ISS	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	ISS	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0051048	negative regulation of se cretion	IDA	biological_process
GO:0051402	neuron apoptotic process	IMP	biological_process
GO:0061098	positive regulation of pr otein tyrosine kinase act ivity	IMP	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IMP	biological_process
GO:2000145	regulation of cell motili ty	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function

KEGG pathways

hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa04144  Endocytosis
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04020  Calcium signaling pathway

Diseases

Associated diseases	References
Addison's disease	PMID: 18593762
Anti-neutrophil cytoplasmic antibody-associated vasculitis	PMID: 19951419
Diabetes	KEGG: H00408, PMID: 21829393
Endometrial cancer	PMID: 23028188
Endometriosis	PMID: 18987482
Multiple sclerosis	PMID: 16143043
Polycystic ovary syndrome (PCOS)	PMID: 26416764
Endometriosis	INFBASE18987482
Schizophrenia	PMID: 16958035

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18987482	Endometrio sis			79 (14 endometr ial samples fro m healthy women , 23 samples fr om endometrium, 10 samples fro m endometriomas , 9 samples fro m peritoneal en dometriosis, 23 samples from w omen with endom etriosis)		HER1 HER2 HER3	Show abstract