Endometriosis Knowledgebase

Search Result

Gene id

207

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

AKT1 Gene UCSC Ensembl

Aliases

AKT, CWS6, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA

Gene name

AKT serine/threonine kinase 1

Alternate names

RAC-alpha serine/threonine-protein kinase, AKT1m, PKB alpha, RAC-PK-alpha, protein kinase B alpha, proto-oncogene c-Akt, rac protein kinase alpha, serine-threonine protein kinase, v-akt murine thymoma viral oncogene homolog 1, v-akt murine thymoma viral oncogene-l,

Gene location

14q32.33 (104795742: 104769348) Exons: 16 NC_000014.9

Gene summary(Entrez)

The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2011]

OMIM

164730

Protein Summary

Protein general information

P31749

Name: RAC alpha serine/threonine protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto oncogene c Akt) (RAC PK alpha)

Length: 480 Mass: 55,686

Tissue specificity: Expressed in prostate cancer and levels increase from the normal to the malignant state (at protein level). Expressed in all human cell types so far analyzed. The Tyr-176 phosphorylated form shows a significant increase in expression i

Sequence

MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFII
RCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEF
EYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCF
VMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPE
AKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIT
PPDQDDSMECVDSERRPHFPQFSYSASGTA

Structural information

Protein Domains	PH. (5-108) Protein (150-408) AGC-kinase (409-480)
Interpro:	IPR000961 IPR034676 IPR011009 IPR011993 IPR001849 IPR017892 IPR000719 IPR017441 IPR008271
Prosite:	PS51285 PS50003 PS00107 PS50011 PS00108
Pfam:	PF00169 PF00069 PF00433
CDD:	cd05594
PDB:	1H10 1UNP 1UNQ 1UNR 2UVM 2UZR 2UZS 3CQU 3CQW 3MV5 3MVH 3O96 3OCB 3OW4 3QKK 3QKL 3QKM 4EJN 4EKK 4EKL 4GV1 5KCV
PDBsum:	1H10 1UNP 1UNQ 1UNR 2UVM 2UZR 2UZS 3CQU 3CQW 3MV5 3MVH 3O96 3OCB 3OW4 3QKK 3QKL 3QKM 4EJN 4EKK 4EKL 4GV1 5KCV
DIP:	24269
MINT:	203775
STRING:	ENSP00000270202;

Other Databases

GeneCards: AKT1; Malacards: AKT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000060	protein import into nucle us, translocation	IMP	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001893	maternal placenta develop ment	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004712	protein serine/threonine/ tyrosine kinase activity	IDA	molecular_function
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IC	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005547	phosphatidylinositol-3,4, 5-trisphosphate binding	IDA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IEA	cellular_component
GO:0005978	glycogen biosynthetic pro cess	IEA	biological_process
GO:0005979	regulation of glycogen bi osynthetic process	IMP	biological_process
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0006412	translation	IEA	biological_process
GO:0006417	regulation of translation	IEA	biological_process
GO:0006464	cellular protein modifica tion process	TAS	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006469	negative regulation of pr otein kinase activity	ISS	biological_process
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0006809	nitric oxide biosynthetic process	TAS	biological_process
GO:0006924	activation-induced cell d eath of T cells	IMP	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006979	response to oxidative str ess	ISS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008286	insulin receptor signalin g pathway	IMP	biological_process
GO:0008637	apoptotic mitochondrial c hanges	IEA	biological_process
GO:0009408	response to heat	TAS	biological_process
GO:0010507	negative regulation of au tophagy	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010748	negative regulation of pl asma membrane long-chain fatty acid transport	IMP	biological_process
GO:0010763	positive regulation of fi broblast migration	IEA	biological_process
GO:0010765	positive regulation of so dium ion transport	IEA	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IMP	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IMP	biological_process
GO:0010975	regulation of neuron proj ection development	ISS	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0015758	glucose transport	IEA	biological_process
GO:0016301	kinase activity	IDA	molecular_function
GO:0016310	phosphorylation	IDA	biological_process
GO:0016567	protein ubiquitination	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	TAS	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IDA	biological_process
GO:0019899	enzyme binding	ISS	molecular_function
GO:0021510	spinal cord development	IEA	biological_process
GO:0030030	cell projection organizat ion	IEA	biological_process
GO:0030154	cell differentiation	TAS	biological_process
GO:0030163	protein catabolic process	IEA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030212	hyaluronan metabolic proc ess	IEA	biological_process
GO:0030235	nitric-oxide synthase reg ulator activity	IMP	molecular_function
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030334	regulation of cell migrat ion	IMP	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0031018	endocrine pancreas develo pment	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031641	regulation of myelination	IEA	biological_process
GO:0031659	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity involved in G1/S tr ansition of mitotic cell cycle	IDA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0031982	vesicle	IDA	cellular_component
GO:0031999	negative regulation of fa tty acid beta-oxidation	IMP	biological_process
GO:0032079	positive regulation of en dodeoxyribonuclease activ ity	IDA	biological_process
GO:0032094	response to food	IEA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	ISS	biological_process
GO:0032287	peripheral nervous system myelin maintenance	IEA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IEA	biological_process
GO:0032794	GTPase activating protein binding	IEA	molecular_function
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034405	response to fluid shear s tress	IMP	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IEA	biological_process
GO:0036064	ciliary basal body	IEA	cellular_component
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	ISS	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0043325	phosphatidylinositol-3,4- bisphosphate binding	IDA	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043491	protein kinase B signalin g	IEA	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IMP	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	NAS	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0045792	negative regulation of ce ll size	IEA	biological_process
GO:0045861	negative regulation of pr oteolysis	IMP	biological_process
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046329	negative regulation of JN K cascade	IEA	biological_process
GO:0046777	protein autophosphorylati on	TAS	biological_process
GO:0046889	positive regulation of li pid biosynthetic process	IMP	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IMP	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051146	striated muscle cell diff erentiation	IEA	biological_process
GO:0051721	protein phosphatase 2A bi nding	IEA	molecular_function
GO:0060416	response to growth hormon e	ISS	biological_process
GO:0060644	mammary gland epithelial cell differentiation	TAS	biological_process
GO:0060709	glycogen cell differentia tion involved in embryoni c placenta development	IEA	biological_process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological_process
GO:0070141	response to UV-A	IDA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071364	cellular response to epid ermal growth factor stimu lus	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071889	14-3-3 protein binding	IPI	molecular_function
GO:0072655	establishment of protein localization to mitochond rion	IMP	biological_process
GO:0072656	maintenance of protein lo cation in mitochondrion	IMP	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IMP	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:0097011	cellular response to gran ulocyte macrophage colony -stimulating factor stimu lus	IEA	biological_process
GO:0097194	execution phase of apopto sis	IEA	biological_process
GO:0098794	postsynapse	IEA	cellular_component
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:0100002	negative regulation of pr otein kinase activity by protein phosphorylation	TAS	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IMP	biological_process
GO:1901215	negative regulation of ne uron death	NAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1901976	regulation of cell cycle checkpoint	TAS	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	NAS	biological_process
GO:1990090	cellular response to nerv e growth factor stimulus	IMP	biological_process
GO:1990418	response to insulin-like growth factor stimulus	ISS	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	TAS	biological_process
GO:0000060	protein import into nucle us, translocation	IMP	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001893	maternal placenta develop ment	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004712	protein serine/threonine/ tyrosine kinase activity	IDA	molecular_function
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IC	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005547	phosphatidylinositol-3,4, 5-trisphosphate binding	IDA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IEA	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0005977	glycogen metabolic proces s	IEA	biological_process
GO:0005977	glycogen metabolic proces s	IEA	biological_process
GO:0005978	glycogen biosynthetic pro cess	IEA	biological_process
GO:0005978	glycogen biosynthetic pro cess	IEA	biological_process
GO:0005979	regulation of glycogen bi osynthetic process	IMP	biological_process
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0006412	translation	IEA	biological_process
GO:0006417	regulation of translation	IEA	biological_process
GO:0006464	cellular protein modifica tion process	TAS	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006469	negative regulation of pr otein kinase activity	IEA	biological_process
GO:0006469	negative regulation of pr otein kinase activity	ISS	biological_process
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0006809	nitric oxide biosynthetic process	TAS	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006924	activation-induced cell d eath of T cells	IMP	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006979	response to oxidative str ess	ISS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008286	insulin receptor signalin g pathway	IEA	biological_process
GO:0008286	insulin receptor signalin g pathway	IMP	biological_process
GO:0008637	apoptotic mitochondrial c hanges	IEA	biological_process
GO:0008643	carbohydrate transport	IEA	biological_process
GO:0009408	response to heat	TAS	biological_process
GO:0009725	response to hormone	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010507	negative regulation of au tophagy	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010748	negative regulation of pl asma membrane long-chain fatty acid transport	IMP	biological_process
GO:0010763	positive regulation of fi broblast migration	IEA	biological_process
GO:0010765	positive regulation of so dium ion transport	IEA	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IMP	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IMP	biological_process
GO:0010975	regulation of neuron proj ection development	IEA	biological_process
GO:0010975	regulation of neuron proj ection development	ISS	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0015758	glucose transport	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016310	phosphorylation	IDA	biological_process
GO:0016567	protein ubiquitination	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	TAS	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IDA	biological_process
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019899	enzyme binding	ISS	molecular_function
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0021510	spinal cord development	IEA	biological_process
GO:0030030	cell projection organizat ion	IEA	biological_process
GO:0030154	cell differentiation	TAS	biological_process
GO:0030163	protein catabolic process	IEA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030212	hyaluronan metabolic proc ess	IEA	biological_process
GO:0030235	nitric-oxide synthase reg ulator activity	IMP	molecular_function
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030334	regulation of cell migrat ion	IEA	biological_process
GO:0030334	regulation of cell migrat ion	IMP	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0031018	endocrine pancreas develo pment	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031641	regulation of myelination	IEA	biological_process
GO:0031659	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity involved in G1/S tr ansition of mitotic cell cycle	IDA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0031982	vesicle	IDA	cellular_component
GO:0031999	negative regulation of fa tty acid beta-oxidation	IMP	biological_process
GO:0032079	positive regulation of en dodeoxyribonuclease activ ity	IDA	biological_process
GO:0032094	response to food	IEA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IEA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	ISS	biological_process
GO:0032287	peripheral nervous system myelin maintenance	IEA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IEA	biological_process
GO:0032794	GTPase activating protein binding	IEA	molecular_function
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0032880	regulation of protein loc alization	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034405	response to fluid shear s tress	IMP	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IEA	biological_process
GO:0036064	ciliary basal body	IEA	cellular_component
GO:0036294	cellular response to decr eased oxygen levels	IEA	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IEA	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	ISS	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0043325	phosphatidylinositol-3,4- bisphosphate binding	IDA	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043491	protein kinase B signalin g	IEA	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IMP	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	NAS	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0045792	negative regulation of ce ll size	IEA	biological_process
GO:0045861	negative regulation of pr oteolysis	IMP	biological_process
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046329	negative regulation of JN K cascade	IEA	biological_process
GO:0046777	protein autophosphorylati on	TAS	biological_process
GO:0046889	positive regulation of li pid biosynthetic process	IMP	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IMP	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051146	striated muscle cell diff erentiation	IEA	biological_process
GO:0051721	protein phosphatase 2A bi nding	IEA	molecular_function
GO:0060416	response to growth hormon e	ISS	biological_process
GO:0060644	mammary gland epithelial cell differentiation	TAS	biological_process
GO:0060709	glycogen cell differentia tion involved in embryoni c placenta development	IEA	biological_process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological_process
GO:0070141	response to UV-A	IDA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0071364	cellular response to epid ermal growth factor stimu lus	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071889	14-3-3 protein binding	IPI	molecular_function
GO:0072655	establishment of protein localization to mitochond rion	IMP	biological_process
GO:0072656	maintenance of protein lo cation in mitochondrion	IMP	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IMP	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	IEA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:0097011	cellular response to gran ulocyte macrophage colony -stimulating factor stimu lus	IEA	biological_process
GO:0097194	execution phase of apopto sis	IEA	biological_process
GO:0098794	postsynapse	IEA	cellular_component
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:0100002	negative regulation of pr otein kinase activity by protein phosphorylation	TAS	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IMP	biological_process
GO:1901215	negative regulation of ne uron death	NAS	biological_process
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1901976	regulation of cell cycle checkpoint	TAS	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	NAS	biological_process
GO:1990090	cellular response to nerv e growth factor stimulus	IEA	biological_process
GO:1990090	cellular response to nerv e growth factor stimulus	IMP	biological_process
GO:1990418	response to insulin-like growth factor stimulus	ISS	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	TAS	biological_process
GO:0000060	protein import into nucle us, translocation	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004712	protein serine/threonine/ tyrosine kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IC	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005547	phosphatidylinositol-3,4, 5-trisphosphate binding	IDA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005979	regulation of glycogen bi osynthetic process	IMP	biological_process
GO:0006464	cellular protein modifica tion process	TAS	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006469	negative regulation of pr otein kinase activity	ISS	biological_process
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0006809	nitric oxide biosynthetic process	TAS	biological_process
GO:0006924	activation-induced cell d eath of T cells	IMP	biological_process
GO:0006979	response to oxidative str ess	ISS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008286	insulin receptor signalin g pathway	IMP	biological_process
GO:0009408	response to heat	TAS	biological_process
GO:0010507	negative regulation of au tophagy	IMP	biological_process
GO:0010748	negative regulation of pl asma membrane long-chain fatty acid transport	IMP	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IMP	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IMP	biological_process
GO:0010975	regulation of neuron proj ection development	ISS	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016301	kinase activity	IDA	molecular_function
GO:0016310	phosphorylation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	TAS	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IDA	biological_process
GO:0019899	enzyme binding	ISS	molecular_function
GO:0030154	cell differentiation	TAS	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030235	nitric-oxide synthase reg ulator activity	IMP	molecular_function
GO:0030307	positive regulation of ce ll growth	IDA	biological_process
GO:0030334	regulation of cell migrat ion	IMP	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0031018	endocrine pancreas develo pment	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031659	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity involved in G1/S tr ansition of mitotic cell cycle	IDA	biological_process
GO:0031982	vesicle	IDA	cellular_component
GO:0031999	negative regulation of fa tty acid beta-oxidation	IMP	biological_process
GO:0032079	positive regulation of en dodeoxyribonuclease activ ity	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	ISS	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034405	response to fluid shear s tress	IMP	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	ISS	biological_process
GO:0043325	phosphatidylinositol-3,4- bisphosphate binding	IDA	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IMP	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	NAS	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0045861	negative regulation of pr oteolysis	IMP	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046777	protein autophosphorylati on	TAS	biological_process
GO:0046889	positive regulation of li pid biosynthetic process	IMP	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IMP	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0060416	response to growth hormon e	ISS	biological_process
GO:0060644	mammary gland epithelial cell differentiation	TAS	biological_process
GO:0070141	response to UV-A	IDA	biological_process
GO:0071889	14-3-3 protein binding	IPI	molecular_function
GO:0072655	establishment of protein localization to mitochond rion	IMP	biological_process
GO:0072656	maintenance of protein lo cation in mitochondrion	IMP	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IMP	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:0100002	negative regulation of pr otein kinase activity by protein phosphorylation	TAS	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IMP	biological_process
GO:1901215	negative regulation of ne uron death	NAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1901976	regulation of cell cycle checkpoint	TAS	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	NAS	biological_process
GO:1990090	cellular response to nerv e growth factor stimulus	IMP	biological_process
GO:1990418	response to insulin-like growth factor stimulus	ISS	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05152  Tuberculosis
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa05224  Breast cancer
hsa05164  Influenza A
hsa04630  Jak-STAT signaling pathway
hsa04068  FoxO signaling pathway
hsa05145  Toxoplasmosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04210  Apoptosis
hsa04668  TNF signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05142  Chagas disease
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa05162  Measles
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa04024  cAMP signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa04722  Neurotrophin signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04371  Apelin signaling pathway
hsa04915  Estrogen signaling pathway
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa04152  AMPK signaling pathway
hsa01524  Platinum drug resistance
hsa05222  Small cell lung cancer
hsa04917  Prolactin signaling pathway
hsa05210  Colorectal cancer
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa04150  mTOR signaling pathway
hsa04931  Insulin resistance
hsa04211  Longevity regulating pathway
hsa05230  Central carbon metabolism in cancer
hsa04071  Sphingolipid signaling pathway
hsa04140  Autophagy - animal
hsa05211  Renal cell carcinoma
hsa04914  Progesterone-mediated oocyte maturation
hsa04920  Adipocytokine signaling pathway
hsa04611  Platelet activation
hsa05231  Choline metabolism in cancer
hsa04213  Longevity regulating pathway
hsa05214  Glioma
hsa05213  Endometrial cancer
hsa04022  cGMP-PKG signaling pathway
hsa05223  Non-small cell lung cancer
hsa04923  Regulation of lipolysis in adipocytes
hsa05221  Acute myeloid leukemia
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04725  Cholinergic synapse
hsa04662  B cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04664  Fc epsilon RI signaling pathway
hsa04728  Dopaminergic synapse
hsa04922  Glucagon signaling pathway
hsa04973  Carbohydrate digestion and absorption
PTHR24356:SF171  CCKR signaling map

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Bipolar disorder	PMID: 18466879
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Diabetes	PMID: 11508278
Endometrial cancer	PMID: 22146979
Endometriosis	PMID: 25912412
Hamartoma tumor syndrome	KEGG: H00539
Hyperandrogenism	PMID: 28271235
Major depressive disorder	PMID: 20033742
Meningioma	KEGG: H01556
Parkinson's disease	PMID: 18395980
Polycystic ovary syndrome (PCOS)	PMID: 22455688
Schizophrenia	PMID: 16395129
Spermatogenetic defects	PMID: 26209830
Endometriosis	INFBASE19429661
Varicocele	PMID: 26209830

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
25912412	Endometrio sis	179 (59 endomet rioid cancers, 36 clear cell c ases, 18 contig uous endometrio sis cases, 66 b enign endometri otic ovarian cy sts)	BAF250a AKT ?H2AX BIM BAX ATM CHK2 Bcl2	Show abstract
25194152	Endometrio sis	60 (35 women wi th endometriosi s, 25 fertile e umenorrheic wom en)	Ki67 SCF Akt GSK3B	Show abstract
20031030	Endometrio sis			Show abstract
24188612	Endometrio sis	32 (18 with end ometriosis, 14 controls)	AKT1 TYMP JAG1 LAMA5 TIMP-1	Show abstract
19429661	Endometrio sis	81 (40 women wi th endometriosi s, 41 controls)	NF1 RHEB mTOR PTEN TSC1 TSC2 KRAS S6K1 TP53 EIF4E LKB1 PIK3CA BECN1 4EBP1 and AKT1	Show abstract
19429661	Endometrio sis	81(40 women wit h endometriosis , 41 controls w ithout endometr iosis)	NF1 RHEB mTOR PTEN TSC1 TSC2 KRAS S6K1 TP53 EIF4E LKB1 �PIK3CA BECN1 4EBP1 and AKT1	Show abstract