Endometriosis Knowledgebase

Search Result

Gene id

2099

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ESR1 Gene UCSC Ensembl

Aliases

ER, ESR, ESRA, ESTRR, Era, NR3A1

Gene name

estrogen receptor 1

Alternate names

estrogen receptor, ER-alpha, estradiol receptor, estrogen nuclear receptor alpha, estrogen receptor alpha E1-E2-1-2, estrogen receptor alpha E1-N2-E2-1-2, nuclear receptor subfamily 3 group A member 1,

Gene location

6q25.1-q25.2 (151654147: 152103273) Exons: 22 NC_000006.12

Gene summary(Entrez)

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Mar 2014]

OMIM

133430

SNPs

rs17847065

Strand:    Allele origin:   Allele change: A/C/T   Mutation type: snp

CM000668.2   g.151808349C>A
CM000668.2   g.151808349C>T
NC_000006.11   g.152129484C>A
NC_000006.11   g.152129484C>T
NC_000006.12   g.151808349C>A
NC_000006.12   g.151808349C>T
NG_008493.2   g.156659C>A
NG_008493.2   g.156659C>T
NM_000125.3   c.437C>A
NM_000125.3   c.437C>T
NM_001122740.1   c.437C>A
NM_001122740.1   c.437C>T
NM_001122741.1   c.437C>A
NM_001122741.1   c.437C>T
NM_001122742.1   c.437C>A
NM_001122742.1   c.437C>T
NM_001291230.1   c.437C>A
NM_001291230.1   c.437C>T
NM_001291241.1   c.437C>A
NM_001291241.1   c.437C>T
NM_001328100.1   c.-990C>A
NM_001328100.1   c.-990C>T
NP_000116.2   p.Pro146Gln
NP_000116.2   p.Pro146Leu
NP_001116212.1   p.Pro146Gln
NP_001116212.1   p.Pro146Leu
NP_001116213.1   p.Pro146Gln
NP_001116213.1   p.Pro146Leu
NP_001116214.1   p.Pro146Gln
NP_001116214.1   p.Pro146Leu
NP_001278159.1   p.Pro146Gln
NP_001278159.1   p.Pro146Leu
NP_001278170.1   p.Pro146Gln
NP_001278170.1   p.Pro146Leu
XP_005266913.1   p.Pro146Gln
XP_005266913.1   p.Pro146Leu
XP_005266914.1   p.Pro146Gln
XP_005266914.1   p.Pro146Leu
XP_006715437.1   p.Pro146Gln
XP_006715437.1   p.Pro146Leu
XP_011533845.1   p.Pro146Gln
XP_011533845.1   p.Pro146Leu
XP_011533846.1   p.Pro146Gln
XP_011533846.1   p.Pro146Leu
XP_011533847.1   p.Pro146Gln
XP_011533847.1   p.Pro146Leu
XP_011533849.1   p.Pro146Gln
XP_011533849.1   p.Pro146Leu
XP_016865865.1   p.Pro146Gln
XP_016865865.1   p.Pro146Leu
XP_016865866.1   p.Pro146Gln
XP_016865866.1   p.Pro146Leu
XP_016865867.1   p.Pro146Gln
XP_016865867.1   p.Pro146Leu
XP_016865868.1   p.Pro146Gln
XP_016865868.1   p.Pro146Leu
XP_016865869.1   p.Pro146Gln
XP_016865869.1   p.Pro146Leu
XP_016865870.1   p.Pro146Gln
XP_016865870.1   p.Pro146Leu
XR_001743222.1   n.807C>A
XR_001743222.1   n.807C>T
XR_001743223.1   n.807C>A
XR_001743223.1   n.807C>T
rs17847076

Strand:    Allele origin:   Allele change: A/T   Mutation type: snp

CM000668.2   g.151842646A>T
NC_000006.11   g.152163781A>T
NC_000006.12   g.151842646A>T
NG_008493.2   g.190956A>T
NM_000125.3   c.502A>T
NM_001122740.1   c.502A>T
NM_001122741.1   c.502A>T
NM_001122742.1   c.502A>T
NM_001291230.1   c.502A>T
NM_001291241.1   c.502A>T
NM_001328100.1   c.-18A>T
NP_000116.2   p.Thr168Ser
NP_001116212.1   p.Thr168Ser
NP_001116213.1   p.Thr168Ser
NP_001116214.1   p.Thr168Ser
NP_001278159.1   p.Thr168Ser
NP_001278170.1   p.Thr168Ser
XP_005266913.1   p.Thr168Ser
XP_005266914.1   p.Thr168Ser
XP_006715437.1   p.Thr168Ser
XP_011533845.1   p.Thr168Ser
XP_011533846.1   p.Thr168Ser
XP_011533847.1   p.Thr168Ser
XP_011533849.1   p.Thr168Ser
XP_016865865.1   p.Thr168Ser
XP_016865866.1   p.Thr168Ser
XP_016865867.1   p.Thr168Ser
XP_016865868.1   p.Thr168Ser
XP_016865869.1   p.Thr168Ser
XP_016865870.1   p.Thr168Ser
XR_001743222.1   n.872A>T
XR_001743223.1   n.872A>T
rs1801132

Strand:    Allele origin:   Allele change: C/G   Mutation type: snp

CM000668.2   g.151944387G>C
NC_000006.11   g.152265522G>C
NC_000006.12   g.151944387G>C
NG_008493.2   g.292697C=
NG_008493.2   g.292697C>G
NM_000125.3   c.975C=
NM_000125.3   c.975C>G
NM_001122740.1   c.975C=
NM_001122740.1   c.975C>G
NM_001122741.1   c.975C=
NM_001122741.1   c.975C>G
NM_001122742.1   c.975C=
NM_001122742.1   c.975C>G
NM_001291230.1   c.981C=
NM_001291230.1   c.981C>G
NM_001291241.1   c.972C=
NM_001291241.1   c.972C>G
NM_001328100.1   c.456C=
NM_001328100.1   c.456C>G
NP_000116.2   p.Pro325=
NP_001116212.1   p.Pro325=
NP_001116213.1   p.Pro325=
NP_001116214.1   p.Pro325=
NP_001278159.1   p.Pro327=
NP_001278170.1   p.Pro324=
NP_001315029.1   p.Pro152=
XP_005266913.1   p.Pro327=
XP_005266914.1   p.Pro324=
XP_006715437.1   p.Pro325=
XP_006715438.1   p.Pro152=
XP_011533845.1   p.Pro325=
XP_011533846.1   p.Pro325=
XP_011533847.1   p.Pro325=
XP_011533849.1   p.Pro325=
XP_011533851.1   p.Pro82=
XP_016865865.1   p.Pro325=
XP_016865866.1   p.Pro325=
XP_016865867.1   p.Pro325=
XP_016865868.1   p.Pro325=
XP_016865869.1   p.Pro325=
XP_016865870.1   p.Pro325=
XP_016865871.1   p.Pro106=
XP_016865872.1   p.Pro62=
XR_001743222.1   n.1345G>C
XR_001743223.1   n.1345G>C
rs1884053

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000668.2   g.151970331C>T
NC_000006.11   g.152291466C>T
NC_000006.12   g.151970331C>T
NG_008493.2   g.318641C>T
NM_000125.3   c.1096+25823C>T
NM_001122740.1   c.1096+25823C>T
NM_001122741.1   c.1096+25823C>T
NM_001122742.1   c.1096+25823C>T
NM_001291230.1   c.1102+25823C>T
NM_001291241.1   c.1093+25823C>T
NM_001328100.1   c.577+25823C>T
XR_001743222.1   n.1466+25823C>T
XR_001743223.1   n.1466+25823C>T
rs1884054

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000668.2   g.151970431C>A
NC_000006.11   g.152291566C>A
NC_000006.12   g.151970431C>A
NG_008493.2   g.318741C>A
NM_000125.3   c.1096+25923C>A
NM_001122740.1   c.1096+25923C>A
NM_001122741.1   c.1096+25923C>A
NM_001122742.1   c.1096+25923C>A
NM_001291230.1   c.1102+25923C>A
NM_001291241.1   c.1093+25923C>A
NM_001328100.1   c.577+25923C>A
XR_001743222.1   n.1466+25923C>A
XR_001743223.1   n.1466+25923C>A
rs2207396

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000668.2   g.152061247G>A
NC_000006.11   g.152382382G>A
NC_000006.12   g.152061247G>A
NG_008493.2   g.409557G>A
NM_000125.3   c.1369+123G>A
NM_001122740.1   c.1369+123G>A
NM_001122741.1   c.1369+123G>A
NM_001122742.1   c.1369+123G>A
NM_001291230.1   c.1375+123G>A
NM_001291241.1   c.1366+123G>A
NM_001328100.1   c.850+123G>A
XR_001743222.1   n.1600+123G>A
XR_001743223.1   n.1600+123G>A
rs2228480

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000668.2   g.152098960G>A
NC_000006.11   g.152420095G>A
NC_000006.12   g.152098960G>A
NG_008493.2   g.447270G>A
NM_000125.3   c.1782G>A
NM_001122740.1   c.1782G>A
NM_001122741.1   c.1782G>A
NM_001122742.1   c.1782G>A
NM_001291230.1   c.1788G>A
NM_001291241.1   c.1779G>A
NM_001328100.1   c.851-26306G>A
NP_000116.2   p.Thr594=
NP_001116212.1   p.Thr594=
NP_001116213.1   p.Thr594=
NP_001116214.1   p.Thr594=
NP_001278159.1   p.Thr596=
NP_001278170.1   p.Thr593=
XP_005266913.1   p.Thr596=
XP_005266914.1   p.Thr593=
XP_006715438.1   p.Thr421=
XP_011533845.1   p.Thr594=
XP_011533846.1   p.Thr594=
XP_011533847.1   p.Thr594=
XP_011533851.1   p.Thr351=
XP_016865865.1   p.Thr594=
XP_016865866.1   p.Thr594=
XP_016865867.1   p.Thr594=
XP_016865868.1   p.Thr594=
XP_016865869.1   p.Thr594=
XP_016865870.1   p.Thr594=
XP_016865871.1   p.Thr375=
XP_016865872.1   p.Thr331=
XR_001743222.1   n.2013G>A
XR_001743223.1   n.1829G>A
rs2347867

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000668.2   g.151908715G>A
NC_000006.11   g.152229850G>A
NC_000006.12   g.151908715G>A
NG_008493.2   g.257025G>A
NM_000125.3   c.760+27944G>A
NM_001122740.1   c.760+27944G>A
NM_001122741.1   c.760+27944G>A
NM_001122742.1   c.760+27944G>A
NM_001291230.1   c.766+27944G>A
NM_001291241.1   c.757+27947G>A
NM_001328100.1   c.241+27944G>A
XR_001743222.1   n.1130+27944G>A
XR_001743223.1   n.1130+27944G>A
rs2234693

Strand: +   Allele origin: unknown  Allele change: C/T   Mutation type: snp

NC_000006.12   g.151842200T>C
NC_000006.11   g.152163335T>C
NG_008493.2   g.190510T>C
NM_000125.3   c.453-397T>C
NM_001122741.1   c.453-397T>C
NM_001122742.1   c.453-397T>C
NM_001122740.1   c.453-397T>C
NM_001291230.1   c.453-397T>C
NM_001291241.1   c.453-397T>C
NM_0013281
rs3853250

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000668.2   g.151838765T>G
NC_000006.11   g.152159900T>G
NC_000006.12   g.151838765T>G
NG_008493.2   g.187075T>G
NM_000125.3   c.453-3832T>G
NM_001122740.1   c.453-3832T>G
NM_001122741.1   c.453-3832T>G
NM_001122742.1   c.453-3832T>G
NM_001291230.1   c.453-3832T>G
NM_001291241.1   c.453-3832T>G
NM_001328100.1   c.-67-3832T>G
XR_001743222.1   n.823-3832T>G
XR_001743223.1   n.823-3832T>G
rs3853251

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000668.2   g.151839621A>G
NC_000006.11   g.152160756A>G
NC_000006.12   g.151839621A>G
NG_008493.2   g.187931A>G
NM_000125.3   c.453-2976A>G
NM_001122740.1   c.453-2976A>G
NM_001122741.1   c.453-2976A>G
NM_001122742.1   c.453-2976A>G
NM_001291230.1   c.453-2976A>G
NM_001291241.1   c.453-2976A>G
NM_001328100.1   c.-67-2976A>G
XR_001743222.1   n.823-2976A>G
XR_001743223.1   n.823-2976A>G
rs6557171

Strand:    Allele origin:   Allele change: A/C/T   Mutation type: snp

CM000668.2   g.151913458T>A
CM000668.2   g.151913458T>C
NC_000006.11   g.152234593T>C
NC_000006.12   g.151913458T>A
NC_000006.12   g.151913458T>C
NG_008493.2   g.261768T>A
NG_008493.2   g.261768T>C
NM_000125.3   c.761-30715T>A
NM_000125.3   c.761-30715T>C
NM_001122740.1   c.761-30715T>A
NM_001122740.1   c.761-30715T>C
NM_001122741.1   c.761-30715T>A
NM_001122741.1   c.761-30715T>C
NM_001122742.1   c.761-30715T>A
NM_001122742.1   c.761-30715T>C
NM_001291230.1   c.767-30715T>A
NM_001291230.1   c.767-30715T>C
NM_001291241.1   c.758-30715T>A
NM_001291241.1   c.758-30715T>C
NM_001328100.1   c.242-30715T>A
NM_001328100.1   c.242-30715T>C
XR_001743222.1   n.1131-30715T>A
XR_001743222.1   n.1131-30715T>C
XR_001743223.1   n.1131-30715T>A
XR_001743223.1   n.1131-30715T>C
rs9322331

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000668.2   g.151841182C>T
NC_000006.11   g.152162317C>G
NC_000006.11   g.152162317C>T
NC_000006.12   g.151841182C>T
NG_008493.2   g.189492C>G
NG_008493.2   g.189492C>T
NM_000125.3   c.453-1415C>G
NM_000125.3   c.453-1415C>T
NM_001122740.1   c.453-1415C>G
NM_001122740.1   c.453-1415C>T
NM_001122741.1   c.453-1415C>G
NM_001122741.1   c.453-1415C>T
NM_001122742.1   c.453-1415C>G
NM_001122742.1   c.453-1415C>T
NM_001291230.1   c.453-1415C>G
NM_001291230.1   c.453-1415C>T
NM_001291241.1   c.453-1415C>G
NM_001291241.1   c.453-1415C>T
NM_001328100.1   c.-67-1415C>G
NM_001328100.1   c.-67-1415C>T
XR_001743222.1   n.823-1415C>T
XR_001743223.1   n.823-1415C>T
rs9340773

Strand:    Allele origin:   Allele change: A/C/G   Mutation type: snp

CM000668.2   g.151808141G>A
CM000668.2   g.151808141G>C
NC_000006.11   g.152129276G>A
NC_000006.12   g.151808141G>A
NC_000006.12   g.151808141G>C
NG_008493.2   g.156451G>A
NG_008493.2   g.156451G>C
NM_000125.3   c.229G>A
NM_000125.3   c.229G>C
NM_001122740.1   c.229G>A
NM_001122740.1   c.229G>C
NM_001122741.1   c.229G>A
NM_001122741.1   c.229G>C
NM_001122742.1   c.229G>A
NM_001122742.1   c.229G>C
NM_001291230.1   c.229G>A
NM_001291230.1   c.229G>C
NM_001291241.1   c.229G>A
NM_001291241.1   c.229G>C
NM_001328100.1   c.-1198G>A
NM_001328100.1   c.-1198G>C
NP_000116.2   p.Gly77Arg
NP_000116.2   p.Gly77Ser
NP_001116212.1   p.Gly77Arg
NP_001116212.1   p.Gly77Ser
NP_001116213.1   p.Gly77Arg
NP_001116213.1   p.Gly77Ser
NP_001116214.1   p.Gly77Arg
NP_001116214.1   p.Gly77Ser
NP_001278159.1   p.Gly77Arg
NP_001278159.1   p.Gly77Ser
NP_001278170.1   p.Gly77Arg
NP_001278170.1   p.Gly77Ser
XP_005266913.1   p.Gly77Ser
XP_005266914.1   p.Gly77Ser
XP_006715437.1   p.Gly77Arg
XP_006715437.1   p.Gly77Ser
XP_011533845.1   p.Gly77Arg
XP_011533845.1   p.Gly77Ser
XP_011533846.1   p.Gly77Arg
XP_011533846.1   p.Gly77Ser
XP_011533847.1   p.Gly77Arg
XP_011533847.1   p.Gly77Ser
XP_011533849.1   p.Gly77Arg
XP_011533849.1   p.Gly77Ser
XP_016865865.1   p.Gly77Arg
XP_016865865.1   p.Gly77Ser
XP_016865866.1   p.Gly77Arg
XP_016865866.1   p.Gly77Ser
XP_016865867.1   p.Gly77Arg
XP_016865867.1   p.Gly77Ser
XP_016865868.1   p.Gly77Arg
XP_016865868.1   p.Gly77Ser
XP_016865869.1   p.Gly77Arg
XP_016865869.1   p.Gly77Ser
XP_016865870.1   p.Gly77Arg
XP_016865870.1   p.Gly77Ser
XR_001743222.1   n.599G>A
XR_001743222.1   n.599G>C
XR_001743223.1   n.599G>A
XR_001743223.1   n.599G>C
rs9340799

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000668.2   g.151842246A>G
NC_000006.11   g.152163381A>G
NC_000006.12   g.151842246A>G
NG_008493.2   g.190556A>G
NM_000125.3   c.453-351A>G
NM_001122740.1   c.453-351A>G
NM_001122741.1   c.453-351A>G
NM_001122742.1   c.453-351A>G
NM_001291230.1   c.453-351A>G
NM_001291241.1   c.453-351A>G
NM_001328100.1   c.-67-351A>G
XR_001743222.1   n.823-351A>G
XR_001743223.1   n.823-351A>G

Protein Summary

Protein general information

P03372

Name: Estrogen receptor (ER) (ER alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)

Length: 595 Mass: 66,216

Tissue specificity: Widely expressed. Isoform 3 is not expressed in the pituitary gland. {ECO

Sequence

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQ
TGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFY
RPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATN
QCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQ
VHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKS
IILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHL
YSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV

Structural information

Interpro:	IPR000536 IPR001723 IPR024178 IPR001292 IPR024736 IPR001628 IPR013088
Prosite:	PS00031 PS51030
Pfam:	PF12743 PF00104 PF02159 PF00105
PDB:	1A52 1AKF 1ERE 1ERR 1G50 1GWQ 1GWR 1HCP 1HCQ 1L2I 1PCG 1QKT 1QKU 1R5K 1SJ0 1UOM 1X7E 1X7R 1XP1 1XP6 1XP9 1XPC 1XQC 1YIM 1YIN 1ZKY 2AYR 2B1V 2B1Z 2B23 2BJ4 2FAI 2G44 2G5O 2I0J 2IOG 2IOK 2JF9 2JFA 2LLO 2LLQ 2OCF 2OUZ 2P15 2POG 2Q6J 2Q70 2QA6 2QA8 2QAB 2QE4
PDBsum:	1A52 1AKF 1ERE 1ERR 1G50 1GWQ 1GWR 1HCP 1HCQ 1L2I 1PCG 1QKT 1QKU 1R5K 1SJ0 1UOM 1X7E 1X7R 1XP1 1XP6 1XP9 1XPC 1XQC 1YIM 1YIN 1ZKY 2AYR 2B1V 2B1Z 2B23 2BJ4 2FAI 2G44 2G5O 2I0J 2IOG 2IOK 2JF9 2JFA 2LLO 2LLQ 2OCF 2OUZ 2P15 2POG 2Q6J 2Q70 2QA6 2QA8 2QAB 2QE4
DIP:	5965
MINT:	129047
STRING:	ENSP00000206249;

Other Databases

GeneCards: ESR1; Malacards: ESR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001046	core promoter sequence-sp ecific DNA binding	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001223	transcription coactivator binding	IEA	molecular_function
GO:0001547	antral ovarian follicle g rowth	IEA	biological_process
GO:0002076	osteoblast development	IEA	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	NAS	molecular_function
GO:0003707	steroid hormone receptor activity	TAS	molecular_function
GO:0005496	steroid binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006338	chromatin remodeling	NAS	biological_process
GO:0006351	transcription, DNA-templa ted	TAS	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	NAS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IDA	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	ISS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0008013	beta-catenin binding	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008209	androgen metabolic proces s	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010863	positive regulation of ph ospholipase C activity	ISS	biological_process
GO:0016020	membrane	NAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030235	nitric-oxide synthase reg ulator activity	NAS	molecular_function
GO:0030284	estrogen receptor activit y	NAS	molecular_function
GO:0030315	T-tubule	IEA	cellular_component
GO:0030518	intracellular steroid hor mone receptor signaling p athway	ISS	biological_process
GO:0030520	intracellular estrogen re ceptor signaling pathway	NAS	biological_process
GO:0031798	type 1 metabotropic gluta mate receptor binding	IEA	molecular_function
GO:0032355	response to estradiol	IDA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0035327	transcriptionally active chromatin	IDA	cellular_component
GO:0036312	phosphatidylinositol 3-ki nase regulatory subunit b inding	IEA	molecular_function
GO:0038052	RNA polymerase II transcr iption factor activity, e strogen-activated sequenc e-specific DNA binding	IDA	molecular_function
GO:0038052	RNA polymerase II transcr iption factor activity, e strogen-activated sequenc e-specific DNA binding	IGI	molecular_function
GO:0042562	hormone binding	IEA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043195	terminal bouton	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IEA	biological_process
GO:0043627	response to estrogen	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046325	negative regulation of gl ucose import	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051117	ATPase binding	IDA	molecular_function
GO:0060009	Sertoli cell development	IEA	biological_process
GO:0060011	Sertoli cell proliferatio n	IEA	biological_process
GO:0060065	uterus development	IEA	biological_process
GO:0060068	vagina development	IEA	biological_process
GO:0060523	prostate epithelial cord elongation	IEA	biological_process
GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA	biological_process
GO:0060687	regulation of branching i nvolved in prostate gland morphogenesis	IEA	biological_process
GO:0060745	mammary gland branching i nvolved in pregnancy	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0060750	epithelial cell prolifera tion involved in mammary gland duct elongation	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0071168	protein localization to c hromatin	IMP	biological_process
GO:0071392	cellular response to estr adiol stimulus	ISS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0090209	negative regulation of tr iglyceride metabolic proc ess	IEA	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1903799	negative regulation of pr oduction of miRNAs involv ed in gene silencing by m iRNA	IMP	biological_process
GO:1990375	baculum development	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001046	core promoter sequence-sp ecific DNA binding	IEA	molecular_function
GO:0001046	core promoter sequence-sp ecific DNA binding	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001223	transcription coactivator binding	IEA	molecular_function
GO:0001547	antral ovarian follicle g rowth	IEA	biological_process
GO:0002064	epithelial cell developme nt	IEA	biological_process
GO:0002076	osteoblast development	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	NAS	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0003707	steroid hormone receptor activity	TAS	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IEA	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005496	steroid binding	ISS	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006338	chromatin remodeling	NAS	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	TAS	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	NAS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IDA	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	ISS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0008013	beta-catenin binding	IPI	molecular_function
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008209	androgen metabolic proces s	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008289	lipid binding	IEA	molecular_function
GO:0008584	male gonad development	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010863	positive regulation of ph ospholipase C activity	ISS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	NAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030235	nitric-oxide synthase reg ulator activity	NAS	molecular_function
GO:0030284	estrogen receptor activit y	IEA	molecular_function
GO:0030284	estrogen receptor activit y	IEA	molecular_function
GO:0030284	estrogen receptor activit y	NAS	molecular_function
GO:0030315	T-tubule	IEA	cellular_component
GO:0030518	intracellular steroid hor mone receptor signaling p athway	IEA	biological_process
GO:0030518	intracellular steroid hor mone receptor signaling p athway	ISS	biological_process
GO:0030520	intracellular estrogen re ceptor signaling pathway	NAS	biological_process
GO:0031798	type 1 metabotropic gluta mate receptor binding	IEA	molecular_function
GO:0032355	response to estradiol	IEA	biological_process
GO:0032355	response to estradiol	IDA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0035327	transcriptionally active chromatin	IDA	cellular_component
GO:0036312	phosphatidylinositol 3-ki nase regulatory subunit b inding	IEA	molecular_function
GO:0038052	RNA polymerase II transcr iption factor activity, e strogen-activated sequenc e-specific DNA binding	IDA	molecular_function
GO:0038052	RNA polymerase II transcr iption factor activity, e strogen-activated sequenc e-specific DNA binding	IGI	molecular_function
GO:0042562	hormone binding	IEA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043195	terminal bouton	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043627	response to estrogen	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046325	negative regulation of gl ucose import	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051117	ATPase binding	IDA	molecular_function
GO:0060009	Sertoli cell development	IEA	biological_process
GO:0060011	Sertoli cell proliferatio n	IEA	biological_process
GO:0060065	uterus development	IEA	biological_process
GO:0060068	vagina development	IEA	biological_process
GO:0060523	prostate epithelial cord elongation	IEA	biological_process
GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA	biological_process
GO:0060687	regulation of branching i nvolved in prostate gland morphogenesis	IEA	biological_process
GO:0060745	mammary gland branching i nvolved in pregnancy	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0060750	epithelial cell prolifera tion involved in mammary gland duct elongation	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0071168	protein localization to c hromatin	IMP	biological_process
GO:0071391	cellular response to estr ogen stimulus	IEA	biological_process
GO:0071392	cellular response to estr adiol stimulus	ISS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0090209	negative regulation of tr iglyceride metabolic proc ess	IEA	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1903799	negative regulation of pr oduction of miRNAs involv ed in gene silencing by m iRNA	IMP	biological_process
GO:1990375	baculum development	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001046	core promoter sequence-sp ecific DNA binding	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	NAS	molecular_function
GO:0003707	steroid hormone receptor activity	TAS	molecular_function
GO:0005496	steroid binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006338	chromatin remodeling	NAS	biological_process
GO:0006351	transcription, DNA-templa ted	TAS	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	NAS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IDA	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	ISS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0008013	beta-catenin binding	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010863	positive regulation of ph ospholipase C activity	ISS	biological_process
GO:0016020	membrane	NAS	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030235	nitric-oxide synthase reg ulator activity	NAS	molecular_function
GO:0030284	estrogen receptor activit y	NAS	molecular_function
GO:0030518	intracellular steroid hor mone receptor signaling p athway	ISS	biological_process
GO:0030520	intracellular estrogen re ceptor signaling pathway	NAS	biological_process
GO:0032355	response to estradiol	IDA	biological_process
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0034056	estrogen response element binding	IDA	molecular_function
GO:0035327	transcriptionally active chromatin	IDA	cellular_component
GO:0038052	RNA polymerase II transcr iption factor activity, e strogen-activated sequenc e-specific DNA binding	IDA	molecular_function
GO:0038052	RNA polymerase II transcr iption factor activity, e strogen-activated sequenc e-specific DNA binding	IGI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043627	response to estrogen	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051117	ATPase binding	IDA	molecular_function
GO:0071168	protein localization to c hromatin	IMP	biological_process
GO:0071392	cellular response to estr adiol stimulus	ISS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:1903799	negative regulation of pr oduction of miRNAs involv ed in gene silencing by m iRNA	IMP	biological_process

KEGG pathways

hsa05205  Proteoglycans in cancer
hsa05224  Breast cancer
hsa01522  Endocrine resistance
hsa04919  Thyroid hormone signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04961  Endocrine and other factor-regulated calcium reabsorption

Diseases

Associated diseases	References
Adenomyosis	PMID: 20979911
Alzheimer's disease	PMID: 11436125
Anorexia nervosa	PMID: 11803451
Asthma	PMID: 19247692
Atherosclerosis	OMIM: 133430
Attention-deficit hyperactivity disorder (ADHD)	PMID: 11140838
Autism	PMID: 19598235
Azoospermia	PMID: 18835831
Azoospermia	PMID: 21430602
Breast cancer	OMIM: 133430
Cholestasis	PMID: 12206920
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Cryptorchidism	PMID: 18452179
Defects in uterine receptivity	PMID: 17118173
Dementia	PMID: 12852830
Depression	PMID: 12605096
Diabetes	PMID: 15167446
Diminished ovarian reserve (DOR)	PMID: 23522078
Dry eye syndrome	PMID: 17378156
Endometrial hyperplasia	PMID: 23690166
Endometriosis	PMID: 15840311
Endometriosis	PMID: 16260521
Female infertility	PMID: 25526766
Genital malformation	PMID: 10484768
Glomerulonephritis	PMID: 19420105
Hypomenorrhea	PMID: 18390216
Hypospadias	PMID: 21934279
Impaired endometrial receptivity	PMID: 21505981
Impaired spermatogenesis	PMID: 18980759
Juvenile arthritis	PMID: 12154211
Kidney disease	PMID: 19578796
Luteal phase defects (LPD)	PMID: 9160186
Male infertility	PMID: 16396937
Metabolic syndrome	PMID: 19032032
Migraine disorders	PMID: 19093296
Mood disorders	PMID: 18449864
Multiple sclerosis	PMID: 12098649
Myocardial infarction	OMIM: 133430
Nonsyndromic cryptorchidism	PMID: 20887985
Obesity	PMID: 19375130
Oligoasthenoteratozoospermia	PMID: 23822672
Oligozoospermia	PMID: 16213843
Osteoarthritis	PMID: 16098017
Osteoporosis	PMID: 18445777
Ovarian dysfunction	PMID: 21269613
Ovarian dysfunction	PMID: 21269613
Ovarian endometriosis	PMID: 18849443
Ovarian endometriosis	PMID: 21518137
Ovarian endometriosis	PMID: 18762229
Ovarian endometriosis	PMID: 11384649
Ovarian endometriosis	PMID: 10856486
Ovarian endometriosis	PMID: 23006437
Ovulatory dysfunction	PMID: 11231990
Parkinson's disease	PMID: 12174171
Periodontitis	PMID: 18846948
Polycystic ovary syndrome (PCOS)	PMID: 18681789
Precocious puberty	PMID: 23559367
Preeclampsia	PMID: 19199249
Premature ovarian failure ( POF)	PMID: 19861327
Premature ovarian failure ( POF)	PMID: 25585503
Premenstrual dysphoric disorder	PMID: 17599809
Psychiatric disorders	PMID: 19086053
Rectosigmoid endometriosis	PMID: 25217304
Recurrent miscarriage	PMID: 19152063
Rectosigmoid endometriosis	INFBASE25217304
Ovarian endometriosis	INFBASE23006437
Endometriosis associated infertility	INFBASE23177411
Ovarian endometriosis	INFBASE21518137
Tubal infertility	INFBASE21269613
Polycystic ovary syndrome (PCOS)	INFBASE21150157
Ovarian dysfunction	INFBASE21269613
Female infertility	INFBASE19729795
Ovarian endometriosis	INFBASE18762229
Ovarian endometriosis	INFBASE18849443
Minimal or mild endometriosis	INFBASE16169423
Leiomyomas	INFBASE17121748
Leiomyomas	INFBASE11139535
Ovarian endometriosis	INFBASE11384649
Ovarian endometriosis	INFBASE10856486
Endometriosis	INFBASE3439444
Adenomyosis	INFBASE8288201
Retinopathy	PMID: 18568888
Rheumatoid arthritis	PMID: 10343533
Scleroderma	PMID: 19032828
Scoliosis	PMID: 19080622
Sertoli cell-only syndrome (SCOS)	PMID: 19886769
Spermatogenetic defects	PMID: 21429951
Spinal ossification	PMID: 12195069
Spondylosis	PMID: 16362385
Systemic lupus erythematosus	PMID: 19399944
Testicular germ cell cancer	PMID: 22245602
Trigeminal neuralgia	PMID: 16430179
Unexplained female infertility	PMID: 21842124
Unexplained infertility	PMID: 24757403
Uterine receptivity	PMID: 17118173
Varicose ulcers	PMID: 16153823

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15840311	Endometrio sis			40 (25 eutopic endometrium, 23 cases of ovari an endometriosi s, 11 cases of vagina-rectum e ndometriosis, 8 cases of perit oneum endometri osis, 16 cases of uterine sero sa endometriosi s )		P450 estrogen receptor (ER)	Show abstract
10605405	Endometrio sis			24 and 7 endome triosis cases		Ki-67 ER PR	Show abstract
10428168	Endometrio sis	ER (Pvu II polymorphism, (TA)n multiallele polymorphism)				ER	Show abstract
8288201	Endometrio sis			31 (18 cases of ovarian endome triosis, 13 cas es of adenomyos is)		ER PR	Show abstract
8513960	Endometrio sis			31 (18 cases of ovarian endome triosis, 13 cas es of adenomyos is)		ER PR	Show abstract
15749482	Endometrio sis	ER alpha* 14 TA repeats, CYP17* A1		221 (119 women with endometrio sis, 108 contro ls)		ER alpha CYP17	Show abstract
18849443	Endometrio sis (ovari an)					CYP1A1 CYP1B1 gamma-syn ER alpha ER beta BCL-2	Show abstract
21150157	Endometrio sis			1		HSD11B1	Show abstract
21110202	Endometrio sis				Female infertility	ESR1 ESR2	Show abstract
21518137	Endometrio sis (ovari an)					SRC-1 transitional intermediary factor 2 (TIF2) SRC-3 and ER	Show abstract
24945100	Endometrio sis			38 women with p eritoneal endom etriosis diagno sed during inve stigation for s econdary infert ility	Female infertility	ERA PR PR-B CRYAB	Show abstract
21269613	Endometrio sis			41 (18 patients with stage IV endometriosis, )		ER-alpha ER-beta PR-A PR-B	Show abstract
25217304	Endometrio sis (Recto sigmoid)			18 consecutive patients with e ndometriosis		HOXA10 ER-A PR PR-B	Show abstract
18687423	Endometrio sis	ERalpha (X allele of ERalpha-XbaI), IL-10 (-592 or -819 C allele )	Chinese	374 (214 affect ed women, 160 c ontrols)		Eralpha IL-10	Show abstract
17454161	Endometrio sis			25 (16 samples of ovarian endo metriosis, 9 of normal endomet rium)		Aromatase 17beta-HSD types 1 17beta-HSD types 7 sulfatase Erbeta Eralpha	Show abstract
16210018	Endometrio sis			74 (37 matched samples from en dometriotic and corresponding endometrial bio psies obtained during the prol iferative and s ecretory phase, 37 endometrial biopsies obtai ned from health y women)		MMP-1 Eralpha Erbeta	Show abstract
19094579	Endometrio sis			90 (60 cases of ovarian endome triotic cysts w ith their corre sponding eutopi c endometrium ( 30 cases of pro liferation phas e and 30 of sec retary phase eu topic endometri um), 30 cases o f normal endome trium (15 proli ferative and 15 secretary phas e endometrial s		Erbeta Eralpha	Show abstract
16855153	Endometrio sis					Eralpha Erbeta	Show abstract
17121748	Endometrio sis	Eralpha (-351 XbaIG, -397 PvuIIC)		328 (112 severe endometriosis, 106 leiomyoma, 110 controls)		ERalpha	Show abstract
16500359	Endometrio sis	ERalpha (PvuII and XbaI) and ERbeta (AluI)		61 women with e ndometriosis		ERalpha	Show abstract
11139535	Endometrio sis	ESR1 (PVUII polymorphism)		382 (203 women with regular me nstrual cycles underwent lapar otomy or laparo scopy and were diagnosed histo logically with endometriosis, adenomyosis and /or leiomyomata , 179 women und ergoing annual health examinat ion were groupe d as reference population)		ESR1	Show abstract
18762229	Endometrio sis (ovari an)					Eralpha Erbeta	Show abstract
16169423	Endometrio sis	PvuII, XbaI, and thymine-adenine (TA) repeat polymorphisms	Korean			ER-alpha	Show abstract
11384649	Endometrio sis (Ovari an and Per itoneal)			70 (33 peritone al endometrial lesions, 37 ova rian endometrio tic lesions)		ER-alpha ER-beta	Show abstract
10856486	Endometrio sis (Ovari an)			47 (32 patients during laparos copic cystectom y, 15 Samples o f ovarian tissu e and endometri um were obtaine d from 15 patie nts during or j ust after surge ry)		ER-alpha	Show abstract
24427778	Endometrio sis	LIF (rs929271), MDM2 (rs2279744), MDM4 (rs1563828), USP7 (rs1529916), and ESR1(rs9340799 and rs2234693) polymorphisms		347 (98 inferti le women with e ndometriosis, 1 15 infertile wo men with at lea st one IVF fail ure and also 13 4 fertile women as controls)	Female infertility	LIF MDM2 MDM4 USP7 ESR1	Show abstract
20586553	Endometrio sis, Endom etriosis a ssociated infertilit y	ESR1 (rs2234693 - T/C single nucleotide polymorphism (SNP), dinucleotide (TA)(n) repeat) and ESR2 (dinucleotide (CA)(n) repeat),progesterone receptor gene PGR (rs10895068 - G/A SNP, 306-bp Alu-insertion), 17?-hydroxysteroid dehydrogenase type 1 gene HSD1		349 (150 endome triosis, 199 co ntrols)	Female infertility	ESR1 ESR2 PGR CYP19A1 and HSD17B1	Show abstract
19729795	Endometrio sis	T/C SNP in intron 1 and exon 2 boundary of estrogen receptor (ER) alpha gene recognized by PvuII enzyme		367 (110 cases of endometriosi s, 142 cases of uterine fibroi ds and 115 heal thy age matched women voluntee rs)			Show abstract
24481237	Endometrio sis			51 (44 endometr iotic tissues ( 39 severe dysme norrhea, 29 dys pareunia, 24 in fertility), 7 m atched eutopic endometrium)	Female infertility	ESR1 ESR2 PGR	Show abstract
23899551	Endometrio sis			41 (15 endometr ium from patien ts, 26 endometr ium from contro ls)		HOXA10 ESR1 CDH1 CDKN1A HRH4 HIST2H3C	Show abstract
21397694	Endometrio sis			20 (11 ovarian endometriosis s amples, 9 contr ol endometrium samples)		ESR1	Show abstract
23177411	Endometrio sis	ESR1(rs1159327 A/G, rs3020348 A/C) and ESR2 (rs17179740 A/G)		669 (157 infert ile and 155 fer tile endometrio sis women as we ll as 92 women with primary in fertility and 2 65 fertile wome n as controls)	Female infertility	ESR1 ESR2	Show abstract
23006437	Endometrio sis (ovari an)			18 (8 moderate endometriosis, 10 severe endom etriosis)		CLOCK ESR1 and MYC	Show abstract
3439444	Endometrio sis			14 patients wit h endometriosis	Female infertility	PRc Erc	Show abstract