Endometriosis Knowledgebase

Search Result

Gene id

2149

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

F2R Gene UCSC Ensembl

Aliases

CF2R, HTR, PAR-1, PAR1, TR

Gene name

coagulation factor II thrombin receptor

Alternate names

proteinase-activated receptor 1, protease-activated receptor 1,

Gene location

5q13.3 (76716042: 76735779) Exons: 3 NC_000005.10

Gene summary(Entrez)

Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]

OMIM

187930

Protein Summary

Protein general information

P25116

Name: Proteinase activated receptor 1 (PAR 1) (Coagulation factor II receptor) (Thrombin receptor)

Length: 425 Mass: 47,441

Tissue specificity: Platelets and vascular endothelial cells.

Sequence

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSIN
KSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVL
FVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLA
IWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYAS
SECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIYKKLLT

Structural information

Interpro:	IPR000276 IPR017452 IPR003912 IPR000935
Prosite:	PS00237 PS50262
Pfam:	PF00001
PDB:	1NRN 1NRO 1NRP 1NRQ 1NRR 3BEF 3HKI 3HKJ 3LU9 3VW7
PDBsum:	1NRN 1NRO 1NRP 1NRQ 1NRR 3BEF 3HKI 3HKJ 3LU9 3VW7
DIP:	29703
STRING:	ENSP00000321326;

Other Databases

GeneCards: F2R; Malacards: F2R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activ ity	ISS	biological_process
GO:0001965	G-protein alpha-subunit b inding	ISS	molecular_function
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	IDA	biological_process
GO:0003105	negative regulation of gl omerular filtration	ISS	biological_process
GO:0004930	G-protein coupled recepto r activity	ISS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IDA	biological_process
GO:0006954	inflammatory response	ISS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	ISS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007205	protein kinase C-activati ng G-protein coupled rece ptor signaling pathway	ISS	biological_process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological_process
GO:0007262	STAT protein import into nucleus	IDA	biological_process
GO:0007529	establishment of synaptic specificity at neuromusc ular junction	ISS	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009611	response to wounding	IDA	biological_process
GO:0009653	anatomical structure morp hogenesis	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0015057	thrombin-activated recept or activity	IDA	molecular_function
GO:0015057	thrombin-activated recept or activity	IDA	molecular_function
GO:0030168	platelet activation	IDA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030193	regulation of blood coagu lation	IDA	biological_process
GO:0030194	positive regulation of bl ood coagulation	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031094	platelet dense tubular ne twork	IDA	cellular_component
GO:0031594	neuromuscular junction	ISS	cellular_component
GO:0031681	G-protein beta-subunit bi nding	ISS	molecular_function
GO:0032496	response to lipopolysacch aride	ISS	biological_process
GO:0032651	regulation of interleukin -1 beta production	ISS	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	ISS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	ISS	biological_process
GO:0045211	postsynaptic membrane	ISS	cellular_component
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045907	positive regulation of va soconstriction	ISS	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	ISS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	ISS	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	ISS	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	ISS	biological_process
GO:0051928	positive regulation of ca lcium ion transport	ISS	biological_process
GO:0051930	regulation of sensory per ception of pain	ISS	biological_process
GO:0060155	platelet dense granule or ganization	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070493	thrombin-activated recept or signaling pathway	IEA	biological_process
GO:1900134	negative regulation of re nin secretion into blood stream	ISS	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	ISS	biological_process
GO:0001965	G-protein alpha-subunit b inding	IEA	molecular_function
GO:0001965	G-protein alpha-subunit b inding	ISS	molecular_function
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	IDA	biological_process
GO:0003105	negative regulation of gl omerular filtration	ISS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	ISS	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	ISS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	ISS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007205	protein kinase C-activati ng G-protein coupled rece ptor signaling pathway	ISS	biological_process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological_process
GO:0007262	STAT protein import into nucleus	IDA	biological_process
GO:0007529	establishment of synaptic specificity at neuromusc ular junction	ISS	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0007599	hemostasis	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009611	response to wounding	IDA	biological_process
GO:0009653	anatomical structure morp hogenesis	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0015057	thrombin-activated recept or activity	IEA	molecular_function
GO:0015057	thrombin-activated recept or activity	IDA	molecular_function
GO:0015057	thrombin-activated recept or activity	IDA	molecular_function
GO:0015057	thrombin-activated recept or activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030168	platelet activation	IDA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030193	regulation of blood coagu lation	IDA	biological_process
GO:0030194	positive regulation of bl ood coagulation	IEA	biological_process
GO:0030194	positive regulation of bl ood coagulation	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031094	platelet dense tubular ne twork	IDA	cellular_component
GO:0031594	neuromuscular junction	ISS	cellular_component
GO:0031681	G-protein beta-subunit bi nding	IEA	molecular_function
GO:0031681	G-protein beta-subunit bi nding	ISS	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032496	response to lipopolysacch aride	ISS	biological_process
GO:0032651	regulation of interleukin -1 beta production	IEA	biological_process
GO:0032651	regulation of interleukin -1 beta production	ISS	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	IEA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	ISS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	ISS	biological_process
GO:0045211	postsynaptic membrane	ISS	cellular_component
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0045907	positive regulation of va soconstriction	ISS	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	ISS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	ISS	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	ISS	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	ISS	biological_process
GO:0051928	positive regulation of ca lcium ion transport	ISS	biological_process
GO:0051930	regulation of sensory per ception of pain	ISS	biological_process
GO:0060155	platelet dense granule or ganization	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070493	thrombin-activated recept or signaling pathway	IEA	biological_process
GO:0070493	thrombin-activated recept or signaling pathway	IEA	biological_process
GO:1900134	negative regulation of re nin secretion into blood stream	IEA	biological_process
GO:1900134	negative regulation of re nin secretion into blood stream	ISS	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	ISS	biological_process
GO:0001965	G-protein alpha-subunit b inding	ISS	molecular_function
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	IDA	biological_process
GO:0003105	negative regulation of gl omerular filtration	ISS	biological_process
GO:0004930	G-protein coupled recepto r activity	ISS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IDA	biological_process
GO:0006954	inflammatory response	ISS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	ISS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007205	protein kinase C-activati ng G-protein coupled rece ptor signaling pathway	ISS	biological_process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological_process
GO:0007262	STAT protein import into nucleus	IDA	biological_process
GO:0007529	establishment of synaptic specificity at neuromusc ular junction	ISS	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009611	response to wounding	IDA	biological_process
GO:0009653	anatomical structure morp hogenesis	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0015057	thrombin-activated recept or activity	IDA	molecular_function
GO:0015057	thrombin-activated recept or activity	IDA	molecular_function
GO:0015057	thrombin-activated recept or activity	TAS	molecular_function
GO:0030168	platelet activation	IDA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030193	regulation of blood coagu lation	IDA	biological_process
GO:0030194	positive regulation of bl ood coagulation	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031094	platelet dense tubular ne twork	IDA	cellular_component
GO:0031594	neuromuscular junction	ISS	cellular_component
GO:0031681	G-protein beta-subunit bi nding	ISS	molecular_function
GO:0032496	response to lipopolysacch aride	ISS	biological_process
GO:0032651	regulation of interleukin -1 beta production	ISS	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	ISS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEP	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	ISS	biological_process
GO:0045211	postsynaptic membrane	ISS	cellular_component
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045907	positive regulation of va soconstriction	ISS	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	ISS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	ISS	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	ISS	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	ISS	biological_process
GO:0051928	positive regulation of ca lcium ion transport	ISS	biological_process
GO:0051930	regulation of sensory per ception of pain	ISS	biological_process
GO:0060155	platelet dense granule or ganization	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:1900134	negative regulation of re nin secretion into blood stream	ISS	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04080  Neuroactive ligand-receptor interaction
hsa04144  Endocytosis
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa04020  Calcium signaling pathway

Diseases

Associated diseases	References
Cardiovascular disease	PMID: 17347481
Endometriosis	PMID: 22201911
Endometriosis	INFBASE22201911
Sertoli cell-only syndrome (SCOS)	PMID: 10731529
Varicocele	PMID: 23603921

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22201911	Endometrio sis					PAR1	Show abstract