Endometriosis Knowledgebase

Search Result

Gene id

2150

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

F2RL1 Gene UCSC Ensembl

Aliases

GPR11, PAR2

Gene name

F2R like trypsin receptor 1

Alternate names

proteinase-activated receptor 2, G-protein coupled receptor 11, coagulation factor II (thrombin) receptor-like 1, protease-activated receptor 2, thrombin receptor-like 1,

Gene location

5q13.3 (76819007: 76835314) Exons: 3 NC_000005.10

Gene summary(Entrez)

This gene encodes a member of the G-protein coupled receptor 1 family of proteins. The encoded cell surface receptor is activated through proteolytic cleavage of its extracellular amino terminus, resulting in a new amino terminus that acts as a tethered ligand that binds to an extracellular loop domain. Activation of the receptor has been shown to stimulate vascular smooth muscle relaxation, dilate blood vessels, increase blood flow, and lower blood pressure. This protein is also important in the inflammatory response, as well as innate and adaptive immunity. [provided by RefSeq, Jun 2016]

OMIM

600933

Protein Summary

Protein general information

P55085

Name: Proteinase activated receptor 2 (PAR 2) (Coagulation factor II receptor like 1) (G protein coupled receptor 11) (Thrombin receptor like 1) [Cleaved into: Proteinase activated receptor 2, alternate cleaved 1; Proteinase activated receptor 2, alternate clea

Length: 397 Mass: 44,126

Tissue specificity: Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon. Moderate expression is detected in many organs, but none in brain or skeletal muscle.

Sequence

MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTT
VFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNV
LIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITT
CHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLT
SKKHSRKSSSYSSSSTTVKTSY

Structural information

Interpro:	IPR000276 IPR017452 IPR002281 IPR003912
Prosite:	PS50262
Pfam:	PF00001
DIP:	42044
MINT:	1326650
STRING:	ENSP00000296677;

Other Databases

GeneCards: F2RL1; Malacards: F2RL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001965	G-protein alpha-subunit b inding	ISS	molecular_function
GO:0002286	T cell activation involve d in immune response	ISS	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IDA	biological_process
GO:0002741	positive regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0003104	positive regulation of gl omerular filtration	ISS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	ISS	molecular_function
GO:0004930	G-protein coupled recepto r activity	IMP	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005769	early endosome	IDA	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0015057	thrombin-activated recept or activity	IEA	molecular_function
GO:0030193	regulation of blood coagu lation	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0030836	positive regulation of ac tin filament depolymeriza tion	IDA	biological_process
GO:0031143	pseudopodium	ISS	cellular_component
GO:0031274	positive regulation of ps eudopodium assembly	ISS	biological_process
GO:0031681	G-protein beta-subunit bi nding	ISS	molecular_function
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0034137	positive regulation of to ll-like receptor 2 signal ing pathway	IMP	biological_process
GO:0034140	negative regulation of to ll-like receptor 3 signal ing pathway	IMP	biological_process
GO:0034141	positive regulation of to ll-like receptor 3 signal ing pathway	IMP	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IDA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	ISS	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	IMP	biological_process
GO:0035926	chemokine (C-C motif) lig and 2 secretion	IDA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043311	positive regulation of eo sinophil degranulation	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045909	positive regulation of va sodilation	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046329	negative regulation of JN K cascade	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0050702	interleukin-1 beta secret ion	IDA	biological_process
GO:0050900	leukocyte migration	IDA	biological_process
GO:0050921	positive regulation of ch emotaxis	ISS	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IDA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0060100	positive regulation of ph agocytosis, engulfment	IDA	biological_process
GO:0061028	establishment of endothel ial barrier	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070493	thrombin-activated recept or signaling pathway	IEA	biological_process
GO:0070661	leukocyte proliferation	ISS	biological_process
GO:0070963	positive regulation of ne utrophil mediated killing of gram-negative bacteri um	IDA	biological_process
GO:0072608	interleukin-10 secretion	IDA	biological_process
GO:0072643	interferon-gamma secretio n	ISS	biological_process
GO:0090195	chemokine secretion	IDA	biological_process
GO:0090195	chemokine secretion	IDA	biological_process
GO:0090198	negative regulation of ch emokine secretion	IDA	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	ISS	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	IDA	biological_process
GO:1900135	positive regulation of re nin secretion into blood stream	ISS	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:0001965	G-protein alpha-subunit b inding	IEA	molecular_function
GO:0001965	G-protein alpha-subunit b inding	ISS	molecular_function
GO:0002286	T cell activation involve d in immune response	IEA	biological_process
GO:0002286	T cell activation involve d in immune response	ISS	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IDA	biological_process
GO:0002741	positive regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0003104	positive regulation of gl omerular filtration	IEA	biological_process
GO:0003104	positive regulation of gl omerular filtration	ISS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	ISS	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IMP	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005769	early endosome	IDA	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0015057	thrombin-activated recept or activity	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030193	regulation of blood coagu lation	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0030836	positive regulation of ac tin filament depolymeriza tion	IDA	biological_process
GO:0031143	pseudopodium	IEA	cellular_component
GO:0031143	pseudopodium	ISS	cellular_component
GO:0031274	positive regulation of ps eudopodium assembly	IEA	biological_process
GO:0031274	positive regulation of ps eudopodium assembly	ISS	biological_process
GO:0031681	G-protein beta-subunit bi nding	IEA	molecular_function
GO:0031681	G-protein beta-subunit bi nding	ISS	molecular_function
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0034137	positive regulation of to ll-like receptor 2 signal ing pathway	IMP	biological_process
GO:0034140	negative regulation of to ll-like receptor 3 signal ing pathway	IMP	biological_process
GO:0034141	positive regulation of to ll-like receptor 3 signal ing pathway	IMP	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IDA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	IEA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	ISS	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	IMP	biological_process
GO:0035926	chemokine (C-C motif) lig and 2 secretion	IDA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043311	positive regulation of eo sinophil degranulation	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045909	positive regulation of va sodilation	IEA	biological_process
GO:0045909	positive regulation of va sodilation	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046329	negative regulation of JN K cascade	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0050702	interleukin-1 beta secret ion	IDA	biological_process
GO:0050900	leukocyte migration	IDA	biological_process
GO:0050921	positive regulation of ch emotaxis	IEA	biological_process
GO:0050921	positive regulation of ch emotaxis	ISS	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IDA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0060100	positive regulation of ph agocytosis, engulfment	IDA	biological_process
GO:0061028	establishment of endothel ial barrier	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070493	thrombin-activated recept or signaling pathway	IEA	biological_process
GO:0070661	leukocyte proliferation	IEA	biological_process
GO:0070661	leukocyte proliferation	ISS	biological_process
GO:0070963	positive regulation of ne utrophil mediated killing of gram-negative bacteri um	IDA	biological_process
GO:0072608	interleukin-10 secretion	IDA	biological_process
GO:0072643	interferon-gamma secretio n	IEA	biological_process
GO:0072643	interferon-gamma secretio n	ISS	biological_process
GO:0090195	chemokine secretion	IEA	biological_process
GO:0090195	chemokine secretion	IDA	biological_process
GO:0090195	chemokine secretion	IDA	biological_process
GO:0090198	negative regulation of ch emokine secretion	IDA	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	IEA	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	ISS	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	IDA	biological_process
GO:1900135	positive regulation of re nin secretion into blood stream	IEA	biological_process
GO:1900135	positive regulation of re nin secretion into blood stream	ISS	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:0001965	G-protein alpha-subunit b inding	ISS	molecular_function
GO:0002286	T cell activation involve d in immune response	ISS	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IDA	biological_process
GO:0002741	positive regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0003104	positive regulation of gl omerular filtration	ISS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	ISS	molecular_function
GO:0004930	G-protein coupled recepto r activity	IMP	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005769	early endosome	IDA	cellular_component
GO:0005794	Golgi apparatus	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0030193	regulation of blood coagu lation	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0030836	positive regulation of ac tin filament depolymeriza tion	IDA	biological_process
GO:0031143	pseudopodium	ISS	cellular_component
GO:0031274	positive regulation of ps eudopodium assembly	ISS	biological_process
GO:0031681	G-protein beta-subunit bi nding	ISS	molecular_function
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0034137	positive regulation of to ll-like receptor 2 signal ing pathway	IMP	biological_process
GO:0034140	negative regulation of to ll-like receptor 3 signal ing pathway	IMP	biological_process
GO:0034141	positive regulation of to ll-like receptor 3 signal ing pathway	IMP	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IDA	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	ISS	biological_process
GO:0035025	positive regulation of Rh o protein signal transduc tion	IMP	biological_process
GO:0035926	chemokine (C-C motif) lig and 2 secretion	IDA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043311	positive regulation of eo sinophil degranulation	IDA	biological_process
GO:0045909	positive regulation of va sodilation	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046329	negative regulation of JN K cascade	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0050702	interleukin-1 beta secret ion	IDA	biological_process
GO:0050900	leukocyte migration	IDA	biological_process
GO:0050921	positive regulation of ch emotaxis	ISS	biological_process
GO:0050927	positive regulation of po sitive chemotaxis	IDA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0060100	positive regulation of ph agocytosis, engulfment	IDA	biological_process
GO:0061028	establishment of endothel ial barrier	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070661	leukocyte proliferation	ISS	biological_process
GO:0070963	positive regulation of ne utrophil mediated killing of gram-negative bacteri um	IDA	biological_process
GO:0072608	interleukin-10 secretion	IDA	biological_process
GO:0072643	interferon-gamma secretio n	ISS	biological_process
GO:0090195	chemokine secretion	IDA	biological_process
GO:0090195	chemokine secretion	IDA	biological_process
GO:0090198	negative regulation of ch emokine secretion	IDA	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	ISS	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	IDA	biological_process
GO:1900135	positive regulation of re nin secretion into blood stream	ISS	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000484	positive regulation of in terleukin-8 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process

KEGG pathways

hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05143  African trypanosomiasis

Diseases

Associated diseases	References
Chronic prostatitis	PMID: 24726923
Endometriosis	PMID: 21546388
Endometriosis	INFBASE16096323

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
21546388	Endometrio sis		PAR2	Show abstract
16096323	Endometrio sis		IL-6 IL-8 PAR2	Show abstract
22201911	Endometrio sis		PAR2	Show abstract
22672593	Endometrio sis	62 (42 women wi th ovarian endo metrioma, 20 e ndometrium tiss ues from women without endomet riosis)	TF PAR-2	Show abstract