Endometriosis Knowledgebase

Search Result

Gene id

2208

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FCER2 Gene UCSC Ensembl

Aliases

BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF

Gene name

Fc fragment of IgE receptor II

Alternate names

low affinity immunoglobulin epsilon Fc receptor, C-type lectin domain family 4, member J, CD23 antigen, Fc epsilon receptor II, Fc fragment of IgE, low affinity II, receptor for (CD23), fc-epsilon-RII, immunoglobulin E-binding factor, immunoglobulin epsilon-chai,

Gene location

19p13.2 (7702754: 7688756) Exons: 12 NC_000019.10

Gene summary(Entrez)

The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

OMIM

151445

Protein Summary

Protein general information

P06734

Name: Low affinity immunoglobulin epsilon Fc receptor (BLAST 2) (C type lectin domain family 4 member J) (Fc epsilon RII) (Immunoglobulin E binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc recepto

Length: 321 Mass: 36,469

Sequence

MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHH
GDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRM
ELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRN
LDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS

Structural information

Protein Domains	C-type (162-284)
Interpro:	IPR001304 IPR016186 IPR018378 IPR033989 IPR016187
Prosite:	PS00615 PS50041
Pfam:	PF00059
CDD:	cd03590
PDB:	1HLI 1KJE 1T8C 1T8D 2H2R 2H2T 4EZM 4G96 4G9A 4GI0 4GJ0 4GJX 4GK1 4GKO 4J6J 4J6K 4J6L 4J6M 4J6N 4J6P 4J6Q 4KI1
PDBsum:	1HLI 1KJE 1T8C 1T8D 2H2R 2H2T 4EZM 4G96 4G9A 4GI0 4GJ0 4GJX 4GK1 4GKO 4J6J 4J6K 4J6L 4J6M 4J6N 4J6P 4J6Q 4KI1
STRING:	ENSP00000264072;

Other Databases

GeneCards: FCER2; Malacards: FCER2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002925	positive regulation of hu moral immune response med iated by circulating immu noglobulin	IEA	biological_process
GO:0005178	integrin binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0019863	IgE binding	IEA	molecular_function
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0002925	positive regulation of hu moral immune response med iated by circulating immu noglobulin	IEA	biological_process
GO:0005178	integrin binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019863	IgE binding	IEA	molecular_function
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005178	integrin binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007219	Notch signaling pathway	TAS	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa05169 Epstein-Barr virus infection
hsa04640 Hematopoietic cell lineage

Diseases

Associated diseases	References
Acute respiratory syndrome	PMID: 17570115
Asthma	PMID: 19663668
Atopy	PMID: 10712310
Cancer	PMID: 18636124
Endometriosis	PMID: 9003095
Parkinson's disease	PMID: 18568448
Endometriosis	INFBASE9003095
Severe Acute Respiratory Syndrome	PMID: 18697825

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
9003095	Endometrio sis			97 (57 patients with pelvic pa in diagnosed as endometriosis, 40 patients wi thout pelvic pa in or endometri osis )		CD23 IgG	Show abstract