Endometriosis Knowledgebase

Search Result

Gene id

2243

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FGA Gene UCSC Ensembl

Aliases

Fib2

Gene name

fibrinogen alpha chain

Alternate names

fibrinogen alpha chain, fibrinogen, A alpha polypeptide,

Gene location

4q31.3 (154590765: 154583125) Exons: 6 NC_000004.12

Gene summary(Entrez)

This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. [provided by RefSeq, Jan 2016]

OMIM

134820

Protein Summary

Protein general information

P02671

Name: Fibrinogen alpha chain [Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain]

Length: 866 Mass: 94,973

Tissue specificity: Detected in blood plasma (at protein level). {ECO

Sequence

MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKCPSGCRMKGLID
EVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIEKVQ
HIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIK
MKPVPDLVPGNFKSQLQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS
GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSAGHWTS
ESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEKVT
SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTAST
GKTFPGFFSPMLGEFVSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS
YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLI
QQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEG
YALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGG
SYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRPLVTQ

Structural information

Protein Domains	Fibrinogen (623-864)
Interpro:	IPR014716 IPR014715 IPR002181 IPR012290 IPR021996 IPR020837
Prosite:	PS00514 PS51406
Pfam:	PF08702 PF12160 PF00147
CDD:	cd00087
PDB:	1BBR 1DM4 1FPH 1FZA 1FZB 1FZC 1FZD 1FZE 1FZF 1FZG 1LT9 1LTJ 1N86 1N8E 1RE3 1RE4 1RF0 1RF1 1YCP 2A45 2FFD 2H43 2HLO 2HOD 2HPC 2OYH 2OYI 2Q9I 2XNX 2XNY 2Z4E 3AT0 3BVH 3E1I 3GHG 3H32 3HUS 4F27 5CFA
PDBsum:	1BBR 1DM4 1FPH 1FZA 1FZB 1FZC 1FZD 1FZE 1FZF 1FZG 1LT9 1LTJ 1N86 1N8E 1RE3 1RE4 1RF0 1RF1 1YCP 2A45 2FFD 2H43 2HLO 2HOD 2HPC 2OYH 2OYI 2Q9I 2XNX 2XNY 2Z4E 3AT0 3BVH 3E1I 3GHG 3H32 3HUS 4F27 5CFA
DIP:	29643
MINT:	1033042
STRING:	ENSP00000306361;

Other Databases

GeneCards: FGA; Malacards: FGA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005198	structural molecule activ ity	IMP	molecular_function
GO:0005198	structural molecule activ ity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005791	rough endoplasmic reticul um	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0006461	protein complex assembly	IMP	biological_process
GO:0006953	acute-phase response	IEA	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030674	protein binding, bridging	IEA	molecular_function
GO:0031091	platelet alpha granule	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031639	plasminogen activation	IDA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0033595	response to genistein	IEA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0042730	fibrinolysis	IDA	biological_process
GO:0043152	induction of bacterial ag glutination	IDA	biological_process
GO:0043278	response to morphine	IEA	biological_process
GO:0043623	cellular protein complex assembly	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045907	positive regulation of va soconstriction	IDA	biological_process
GO:0045921	positive regulation of ex ocytosis	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046898	response to cycloheximide	IEA	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0051258	protein polymerization	IDA	biological_process
GO:0051592	response to calcium ion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070527	platelet aggregation	IMP	biological_process
GO:0070527	platelet aggregation	IDA	biological_process
GO:0071354	cellular response to inte rleukin-6	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0072377	blood coagulation, common pathway	IMP	biological_process
GO:0072377	blood coagulation, common pathway	IMP	biological_process
GO:0072378	blood coagulation, fibrin clot formation	IDA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:0090277	positive regulation of pe ptide hormone secretion	IDA	biological_process
GO:0097421	liver regeneration	IEA	biological_process
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	NAS	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IDA	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:1990643	cellular response to gran ulocyte colony-stimulatin g factor	IEA	biological_process
GO:2000261	negative regulation of bl ood coagulation, common p athway	TAS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:0005102	receptor binding	IDA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IDA	molecular_function
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005198	structural molecule activ ity	IMP	molecular_function
GO:0005198	structural molecule activ ity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005577	fibrinogen complex	IEA	cellular_component
GO:0005577	fibrinogen complex	TAS	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005791	rough endoplasmic reticul um	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0006461	protein complex assembly	IMP	biological_process
GO:0006953	acute-phase response	IEA	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0007599	hemostasis	IEA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0030168	platelet activation	IEA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030674	protein binding, bridging	IEA	molecular_function
GO:0031091	platelet alpha granule	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031639	plasminogen activation	IDA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0033595	response to genistein	IEA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0042730	fibrinolysis	IDA	biological_process
GO:0043152	induction of bacterial ag glutination	IDA	biological_process
GO:0043278	response to morphine	IEA	biological_process
GO:0043623	cellular protein complex assembly	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045907	positive regulation of va soconstriction	IDA	biological_process
GO:0045921	positive regulation of ex ocytosis	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046898	response to cycloheximide	IEA	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0051258	protein polymerization	IEA	biological_process
GO:0051258	protein polymerization	IDA	biological_process
GO:0051592	response to calcium ion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070527	platelet aggregation	IMP	biological_process
GO:0070527	platelet aggregation	IDA	biological_process
GO:0071345	cellular response to cyto kine stimulus	IEA	biological_process
GO:0071354	cellular response to inte rleukin-6	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0072377	blood coagulation, common pathway	IMP	biological_process
GO:0072377	blood coagulation, common pathway	IMP	biological_process
GO:0072378	blood coagulation, fibrin clot formation	IDA	biological_process
GO:0072562	blood microparticle	IEA	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component
GO:0090277	positive regulation of pe ptide hormone secretion	IDA	biological_process
GO:0097421	liver regeneration	IEA	biological_process
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	NAS	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IDA	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:1990643	cellular response to gran ulocyte colony-stimulatin g factor	IEA	biological_process
GO:2000261	negative regulation of bl ood coagulation, common p athway	TAS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:0005102	receptor binding	IDA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IDA	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005198	structural molecule activ ity	IMP	molecular_function
GO:0005198	structural molecule activ ity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005577	fibrinogen complex	TAS	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	IMP	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031091	platelet alpha granule	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031639	plasminogen activation	IDA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0042730	fibrinolysis	IDA	biological_process
GO:0043152	induction of bacterial ag glutination	IDA	biological_process
GO:0043623	cellular protein complex assembly	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045907	positive regulation of va soconstriction	IDA	biological_process
GO:0045921	positive regulation of ex ocytosis	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0051258	protein polymerization	IDA	biological_process
GO:0051592	response to calcium ion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070527	platelet aggregation	IMP	biological_process
GO:0070527	platelet aggregation	IDA	biological_process
GO:0072377	blood coagulation, common pathway	IMP	biological_process
GO:0072377	blood coagulation, common pathway	IMP	biological_process
GO:0072378	blood coagulation, fibrin clot formation	IDA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:0090277	positive regulation of pe ptide hormone secretion	IDA	biological_process
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	NAS	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IDA	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:2000261	negative regulation of bl ood coagulation, common p athway	TAS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:0005102	receptor binding	IDA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IDA	molecular_function

KEGG pathways

hsa04610 Complement and coagulation cascades
hsa04611 Platelet activation

Diseases

Associated diseases	References
Afibrinogenemia	KEGG: H00222, OMIM: 134820
Alzheimer's disease	PMID: 19141999
Amyloidosis	OMIM: 134820
Endometriosis	PMID: 25673457
Familial amyloidosis	KEGG: H00845
Glomerulonephritis	PMID: 19420105
Hypodysfibrinogenemia	OMIM: 134820
Inherited thrombophilia	KEGG: H00223
Macular degeneration	PMID: 18842294
Obesity	PMID: 15795809
Endometriosis	INFBASE25673457
Renal amyloidosis	PMID: 8097946
Stroke	PMID: 15968394
Thrombophilia	PMID: 8473507

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25673457	Endometrio sis			124 (50 patient s with endometr iosis, 34 with benign ovarian neoplasms, 40 h ealthy voluntee rs)			Show abstract