Endometriosis Knowledgebase

Search Result

Gene id

2246

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FGF1 Gene UCSC Ensembl

Aliases

AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1

Gene name

fibroblast growth factor 1

Alternate names

fibroblast growth factor 1, beta-endothelial cell growth factor, endothelial cell growth factor, alpha, endothelial cell growth factor, beta, fibroblast growth factor 1 (acidic), heparin-binding growth factor 1,

Gene location

5q31.3 (142698069: 142592177) Exons: 9 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]

OMIM

131220

Protein Summary

Protein general information

P05230

Name: Fibroblast growth factor 1 (FGF 1) (Acidic fibroblast growth factor) (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin binding growth factor 1) (HBGF 1)

Length: 155 Mass: 17,460

Tissue specificity: Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle. {ECO

Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTE
TGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPL
PVSSD

Structural information

Motifs	Nuclear localization(24-27)
Interpro:	IPR028210 IPR002209 IPR008996
Prosite:	PS00247
Pfam:	PF00167
CDD:	cd00058
PDB:	1AXM 1DJS 1DZC 1DZD 1E0O 1EVT 1HKN 1JQZ 1JT3 1JT4 1JT5 1JT7 1JTC 1JY0 1K5U 1K5V 1M16 1NZK 1P63 1PZZ 1Q03 1Q04 1QCT 1RG8 1RML 1RY7 1YTO 1Z2V 1Z4S 2AFG 2AQZ 2AXM 2ERM 2HW9 2HWA 2HWM 2HZ9 2K43 2K4A 2K8R 2KI4 2KI6 2NTD 2Q9X 2RQ9 3B9U 3BA4 3BA5 3BA7 3BAD 3BAG
PDBsum:	1AXM 1DJS 1DZC 1DZD 1E0O 1EVT 1HKN 1JQZ 1JT3 1JT4 1JT5 1JT7 1JTC 1JY0 1K5U 1K5V 1M16 1NZK 1P63 1PZZ 1Q03 1Q04 1QCT 1RG8 1RML 1RY7 1YTO 1Z2V 1Z4S 2AFG 2AQZ 2AXM 2ERM 2HW9 2HWA 2HWM 2HZ9 2K43 2K4A 2K8R 2KI4 2KI6 2NTD 2Q9X 2RQ9 3B9U 3BA4 3BA5 3BA7 3BAD 3BAG
DIP:	3787
MINT:	118570
STRING:	ENSP00000338548;

Other Databases

GeneCards: FGF1; Malacards: FGF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000187	activation of MAPK activi ty	IMP	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001759	organ induction	IEA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IMP	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008201	heparin binding	IMP	molecular_function
GO:0008201	heparin binding	IDA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IPI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IMP	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IDA	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0009653	anatomical structure morp hogenesis	TAS	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030544	Hsp70 protein binding	IEA	molecular_function
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0034605	cellular response to heat	IDA	biological_process
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0045542	positive regulation of ch olesterol biosynthetic pr ocess	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IDA	biological_process
GO:0060681	branch elongation involve d in ureteric bud branchi ng	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0072163	mesonephric epithelium de velopment	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IMP	biological_process
GO:1902533	positive regulation of in tracellular signal transd uction	IDA	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IMP	biological_process
GO:2000544	regulation of endothelial cell chemotaxis to fibro blast growth factor	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000187	activation of MAPK activi ty	IMP	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001759	organ induction	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IMP	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008201	heparin binding	IMP	molecular_function
GO:0008201	heparin binding	IDA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IEA	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IPI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IMP	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IDA	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0009653	anatomical structure morp hogenesis	TAS	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030544	Hsp70 protein binding	IEA	molecular_function
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0034605	cellular response to heat	IDA	biological_process
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0045542	positive regulation of ch olesterol biosynthetic pr ocess	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IDA	biological_process
GO:0060681	branch elongation involve d in ureteric bud branchi ng	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0072163	mesonephric epithelium de velopment	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IMP	biological_process
GO:1902533	positive regulation of in tracellular signal transd uction	IDA	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IMP	biological_process
GO:2000544	regulation of endothelial cell chemotaxis to fibro blast growth factor	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000187	activation of MAPK activi ty	IMP	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular_function
GO:0005104	fibroblast growth factor receptor binding	IMP	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008201	heparin binding	IMP	molecular_function
GO:0008201	heparin binding	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IPI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IMP	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IDA	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IGI	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological_process
GO:0009653	anatomical structure morp hogenesis	TAS	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0034605	cellular response to heat	IDA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0045542	positive regulation of ch olesterol biosynthetic pr ocess	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0051781	positive regulation of ce ll division	IDA	biological_process
GO:0060681	branch elongation involve d in ureteric bud branchi ng	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0072163	mesonephric epithelium de velopment	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IMP	biological_process
GO:1902533	positive regulation of in tracellular signal transd uction	IDA	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IMP	biological_process
GO:2000544	regulation of endothelial cell chemotaxis to fibro blast growth factor	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa05224  Breast cancer
hsa04810  Regulation of actin cytoskeleton
hsa04390  Hippo signaling pathway
hsa05218  Melanoma

Diseases

Associated diseases	References
Adenomyosis	PMID: 20504870
Alzheimer's disease	PMID: 15358178
Cardiomegaly	PMID: 12750963
Celiac disease	PMID: 19845895
Endometrial cancer	PMID: 8685603
Endometriosis	PMID: 12846675
Implantation failure	PMID: 23426545
Multiple sclerosis	PMID: 18563468
Oocyte maturity and fertilization	PMID: 11438326
Psoriasis	PMID: 17204151
Endometriosis	INFBASE12788899

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27128987	Endometrio sis			94 (74 endometr iosis patients (stages I-II: 4 0; stages III-I V: 34) , 20 wom en without endo metriosis)	Female infertility		Show abstract
12788899	Endometrio sis			53 (29 women wi thout endometri osis, 24 patien ts affected by the disease)		FGF FGF-AS	Show abstract