Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 2247
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol FGF2   Gene   UCSC   Ensembl
Aliases BFGF, FGF-2, FGFB, HBGF-2
Gene name fibroblast growth factor 2
Alternate names fibroblast growth factor 2, basic fibroblast growth factor bFGF, fibroblast growth factor 2 (basic), heparin-binding growth factor 2, prostatropin,
Gene location 4q28.1 (122826707: 122898234)     Exons: 3     NC_000004.12
Gene summary(Entrez) The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008]
OMIM 134920

Protein Summary

Protein general information P09038  

Name: Fibroblast growth factor 2 (FGF 2) (Basic fibroblast growth factor) (bFGF) (Heparin binding growth factor 2) (HBGF 2)

Length: 288  Mass: 30,770

Tissue specificity: Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. {ECO

Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPS
GSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGG
SGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLL
ASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Structural information

Motifs
Cell attachment(179-181)
({ECO:0000255}-)
Cell attachment(221-223)
({ECO:0000255}.-)
Interpro:  IPR028223 IPR002209 IPR008996
Prosite:   PS00247

Pfam:  
PF00167
CDD:   cd00058

PDB:  
1BAS 1BFB 1BFC 1BFF 1BFG 1BLA 1BLD 1CVS 1EV2 1FGA 1FQ9 1II4 1IIL 2BFH 2FGF 2M49 4FGF 4OEE 4OEF 4OEG
PDBsum:   1BAS 1BFB 1BFC 1BFF 1BFG 1BLA 1BLD 1CVS 1EV2 1FGA 1FQ9 1II4 1IIL 2BFH 2FGF 2M49 4FGF 4OEE 4OEF 4OEG

DIP:  
4012
MINT:   222469
STRING:   ENSP00000264498;
Other Databases GeneCards:  FGF2;  Malacards:  FGF2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000165 MAPK cascade
TAS biological_process
GO:0000187 activation of MAPK activi
ty
TAS biological_process
GO:0001658 branching involved in ure
teric bud morphogenesis
IDA biological_process
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IMP biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IDA biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IGI biological_process
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular_function
GO:0005104 fibroblast growth factor
receptor binding
IPI molecular_function
GO:0005125 cytokine activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0006661 phosphatidylinositol bios
ynthetic process
IDA biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0007165 signal transduction
NAS biological_process
GO:0007265 Ras protein signal transd
uction
TAS biological_process
GO:0007399 nervous system developmen
t
TAS biological_process
GO:0008083 growth factor activity
IDA molecular_function
GO:0008201 heparin binding
IEA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
IGI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IPI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IDA biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IGI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0009887 animal organ morphogenesi
s
TAS biological_process
GO:0010764 negative regulation of fi
broblast migration
IDA biological_process
GO:0010863 positive regulation of ph
ospholipase C activity
IDA biological_process
GO:0014066 regulation of phosphatidy
linositol 3-kinase signal
ing
TAS biological_process
GO:0014843 growth factor dependent r
egulation of skeletal mus
cle satellite cell prolif
eration
IMP biological_process
GO:0016303 1-phosphatidylinositol-3-
kinase activity
TAS molecular_function
GO:0018108 peptidyl-tyrosine phospho
rylation
IEA biological_process
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030214 hyaluronan catabolic proc
ess
IDA biological_process
GO:0030374 ligand-dependent nuclear
receptor transcription co
activator activity
IDA molecular_function
GO:0032958 inositol phosphate biosyn
thetic process
IDA biological_process
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological_process
GO:0036092 phosphatidylinositol-3-ph
osphate biosynthetic proc
ess
IEA biological_process
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0042060 wound healing
IDA biological_process
GO:0042060 wound healing
TAS biological_process
GO:0042660 positive regulation of ce
ll fate specification
IDA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043537 negative regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043547 positive regulation of GT
Pase activity
IEA biological_process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IDA biological_process
GO:0045765 regulation of angiogenesi
s
TAS biological_process
GO:0045766 positive regulation of an
giogenesis
IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0046854 phosphatidylinositol phos
phorylation
IEA biological_process
GO:0046934 phosphatidylinositol-4,5-
bisphosphate 3-kinase act
ivity
TAS molecular_function
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological_process
GO:0048598 embryonic morphogenesis
TAS biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0051209 release of sequestered ca
lcium ion into cytosol
IDA biological_process
GO:0051781 positive regulation of ce
ll division
IEA biological_process
GO:0060045 positive regulation of ca
rdiac muscle cell prolife
ration
IDA biological_process
GO:0060548 negative regulation of ce
ll death
IDA biological_process
GO:0060591 chondroblast differentiat
ion
IDA biological_process
GO:0061045 negative regulation of wo
und healing
IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IC biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:1903672 positive regulation of sp
routing angiogenesis
IDA biological_process
GO:1903672 positive regulation of sp
routing angiogenesis
IMP biological_process
GO:2000544 regulation of endothelial
cell chemotaxis to fibro
blast growth factor
IDA biological_process
GO:2000546 positive regulation of en
dothelial cell chemotaxis
to fibroblast growth fac
tor
IDA biological_process
GO:0000165 MAPK cascade
TAS biological_process
GO:0000187 activation of MAPK activi
ty
TAS biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001658 branching involved in ure
teric bud morphogenesis
IDA biological_process
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IMP biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IDA biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IGI biological_process
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular_function
GO:0005102 receptor binding
IEA molecular_function
GO:0005104 fibroblast growth factor
receptor binding
IEA molecular_function
GO:0005104 fibroblast growth factor
receptor binding
IPI molecular_function
GO:0005125 cytokine activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0006661 phosphatidylinositol bios
ynthetic process
IDA biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0007165 signal transduction
NAS biological_process
GO:0007265 Ras protein signal transd
uction
TAS biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0007399 nervous system developmen
t
TAS biological_process
GO:0008083 growth factor activity
IEA molecular_function
GO:0008083 growth factor activity
IEA molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0008201 heparin binding
IEA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
IGI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IEA biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IPI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IDA biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IGI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0009887 animal organ morphogenesi
s
TAS biological_process
GO:0010764 negative regulation of fi
broblast migration
IDA biological_process
GO:0010863 positive regulation of ph
ospholipase C activity
IDA biological_process
GO:0014066 regulation of phosphatidy
linositol 3-kinase signal
ing
TAS biological_process
GO:0014843 growth factor dependent r
egulation of skeletal mus
cle satellite cell prolif
eration
IMP biological_process
GO:0016303 1-phosphatidylinositol-3-
kinase activity
TAS molecular_function
GO:0018108 peptidyl-tyrosine phospho
rylation
IEA biological_process
GO:0030154 cell differentiation
IEA biological_process
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030214 hyaluronan catabolic proc
ess
IDA biological_process
GO:0030374 ligand-dependent nuclear
receptor transcription co
activator activity
IDA molecular_function
GO:0032958 inositol phosphate biosyn
thetic process
IDA biological_process
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological_process
GO:0036092 phosphatidylinositol-3-ph
osphate biosynthetic proc
ess
IEA biological_process
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0042060 wound healing
IDA biological_process
GO:0042060 wound healing
TAS biological_process
GO:0042660 positive regulation of ce
ll fate specification
IDA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043537 negative regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043547 positive regulation of GT
Pase activity
IEA biological_process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IDA biological_process
GO:0045765 regulation of angiogenesi
s
TAS biological_process
GO:0045766 positive regulation of an
giogenesis
IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0046854 phosphatidylinositol phos
phorylation
IEA biological_process
GO:0046934 phosphatidylinositol-4,5-
bisphosphate 3-kinase act
ivity
TAS molecular_function
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological_process
GO:0048598 embryonic morphogenesis
TAS biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0051209 release of sequestered ca
lcium ion into cytosol
IDA biological_process
GO:0051781 positive regulation of ce
ll division
IEA biological_process
GO:0060045 positive regulation of ca
rdiac muscle cell prolife
ration
IDA biological_process
GO:0060548 negative regulation of ce
ll death
IDA biological_process
GO:0060591 chondroblast differentiat
ion
IDA biological_process
GO:0061045 negative regulation of wo
und healing
IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IC biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:1903672 positive regulation of sp
routing angiogenesis
IDA biological_process
GO:1903672 positive regulation of sp
routing angiogenesis
IMP biological_process
GO:2000544 regulation of endothelial
cell chemotaxis to fibro
blast growth factor
IDA biological_process
GO:2000546 positive regulation of en
dothelial cell chemotaxis
to fibroblast growth fac
tor
IDA biological_process
GO:0000165 MAPK cascade
TAS biological_process
GO:0000187 activation of MAPK activi
ty
TAS biological_process
GO:0001658 branching involved in ure
teric bud morphogenesis
IDA biological_process
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IMP biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IDA biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IGI biological_process
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular_function
GO:0005104 fibroblast growth factor
receptor binding
IPI molecular_function
GO:0005125 cytokine activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0006661 phosphatidylinositol bios
ynthetic process
IDA biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0007165 signal transduction
NAS biological_process
GO:0007265 Ras protein signal transd
uction
TAS biological_process
GO:0007399 nervous system developmen
t
TAS biological_process
GO:0008083 growth factor activity
IDA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
IGI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IPI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IDA biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IGI biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological_process
GO:0009887 animal organ morphogenesi
s
TAS biological_process
GO:0010764 negative regulation of fi
broblast migration
IDA biological_process
GO:0010863 positive regulation of ph
ospholipase C activity
IDA biological_process
GO:0014066 regulation of phosphatidy
linositol 3-kinase signal
ing
TAS biological_process
GO:0014843 growth factor dependent r
egulation of skeletal mus
cle satellite cell prolif
eration
IMP biological_process
GO:0016303 1-phosphatidylinositol-3-
kinase activity
TAS molecular_function
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030214 hyaluronan catabolic proc
ess
IDA biological_process
GO:0030374 ligand-dependent nuclear
receptor transcription co
activator activity
IDA molecular_function
GO:0032958 inositol phosphate biosyn
thetic process
IDA biological_process
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological_process
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0042060 wound healing
IDA biological_process
GO:0042060 wound healing
TAS biological_process
GO:0042660 positive regulation of ce
ll fate specification
IDA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IDA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043537 negative regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IDA biological_process
GO:0045765 regulation of angiogenesi
s
TAS biological_process
GO:0045766 positive regulation of an
giogenesis
IDA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0046934 phosphatidylinositol-4,5-
bisphosphate 3-kinase act
ivity
TAS molecular_function
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological_process
GO:0048598 embryonic morphogenesis
TAS biological_process
GO:0051209 release of sequestered ca
lcium ion into cytosol
IDA biological_process
GO:0060045 positive regulation of ca
rdiac muscle cell prolife
ration
IDA biological_process
GO:0060548 negative regulation of ce
ll death
IDA biological_process
GO:0060591 chondroblast differentiat
ion
IDA biological_process
GO:0061045 negative regulation of wo
und healing
IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IC biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:1903672 positive regulation of sp
routing angiogenesis
IDA biological_process
GO:1903672 positive regulation of sp
routing angiogenesis
IMP biological_process
GO:2000544 regulation of endothelial
cell chemotaxis to fibro
blast growth factor
IDA biological_process
GO:2000546 positive regulation of en
dothelial cell chemotaxis
to fibroblast growth fac
tor
IDA biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05224  Breast cancer
hsa04810  Regulation of actin cytoskeleton
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa05218  Melanoma

Diseases

Associated diseases References
Adenomyosis PMID: 20504870
Ataxia PMID: 12590983
Cancer PMID: 19456219
Diabetes PMID: 19930868
Endometriosis PMID: 17578349
Gastrointestinal diseases PMID: 19586755
Myopia PMID: 19710942
Psoriasis PMID: 17204151
Adenomyosis INFBASE20504870
Endometriosis INFBASE20504870

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
20504870 Endometrio
sis
FGF1 -1385A/G, FGF2 754C/G polymorphisms Chinese
Han
1380 ((421 EM p
atients, 421 co
ntrols), (269 a
denomyosis pati
ents, 269 contr
ols))
FGF1
FGF2
Show abstract
17578349 Endometrio
sis

66 (35 women wi
th advanced sta
ge endometriosi
s, 31 control w
omen)
EGF
FGF-2
PDGF-A
Show abstract
16522409 Endometrio
sis

39 (25 women wi
th endometriosi
s, 14 healthy c
ontrols)
FGF-2
Show abstract
15672963 Endometrio
sis

63 women with v
arious stages o
f endometriosis
IL-6
b-FGF
IL-8
Show abstract
12788899 Endometrio
sis

53 (29 women wi
thout endometri
osis, 24 patien
ts affected by
the disease)
FGF
FGF-AS
Show abstract