Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 2277
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol VEGFD   Gene   UCSC   Ensembl
Aliases FIGF, VEGF-D
Gene name vascular endothelial growth factor D
Alternate names vascular endothelial growth factor D, c-fos induced growth factor (vascular endothelial growth factor D),
Gene location Xp22.2 (15384412: 15345590)     Exons: 7     NC_000023.11
Gene summary(Entrez) The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus. [provided by RefSeq, Feb 2011]
OMIM 300091

Protein Summary

Protein general information O43915  

Name: Vascular endothelial growth factor D (VEGF D) (c Fos induced growth factor) (FIGF)

Length: 354  Mass: 40,444

Tissue specificity: Highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas.

Sequence MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLRLKSFT
SMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEES
LICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPID
MLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
Structural information
Interpro:  IPR029034 IPR023581 IPR000072
Prosite:   PS00249 PS50278

Pfam:  
PF00341
CDD:   cd00135

PDB:  
2XV7
PDBsum:   2XV7
STRING:   ENSP00000297904;
Other Databases GeneCards:  VEGFD;  Malacards:  VEGFD

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001525 angiogenesis
IEA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0005161 platelet-derived growth f
actor receptor binding
TAS molecular_function
GO:0005172 vascular endothelial grow
th factor receptor bindin
g
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0008083 growth factor activity
IEA molecular_function
GO:0008283 cell proliferation
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0030947 regulation of vascular en
dothelial growth factor r
eceptor signaling pathway
IEA biological_process
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0032755 positive regulation of in
terleukin-6 production
IEA biological_process
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0042803 protein homodimerization
activity
IEA molecular_function
GO:0043185 vascular endothelial grow
th factor receptor 3 bind
ing
IEA molecular_function
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0050930 induction of positive che
motaxis
IDA biological_process
GO:0051781 positive regulation of ce
ll division
IEA biological_process
GO:0060754 positive regulation of ma
st cell chemotaxis
IDA biological_process
GO:0070555 response to interleukin-1
IEA biological_process
GO:0071542 dopaminergic neuron diffe
rentiation
IEA biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0005161 platelet-derived growth f
actor receptor binding
TAS molecular_function
GO:0005172 vascular endothelial grow
th factor receptor bindin
g
IEA molecular_function
GO:0005172 vascular endothelial grow
th factor receptor bindin
g
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0008083 growth factor activity
IEA molecular_function
GO:0008083 growth factor activity
IEA molecular_function
GO:0008083 growth factor activity
IEA molecular_function
GO:0008283 cell proliferation
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0016020 membrane
IEA cellular_component
GO:0030154 cell differentiation
IEA biological_process
GO:0030947 regulation of vascular en
dothelial growth factor r
eceptor signaling pathway
IEA biological_process
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0032755 positive regulation of in
terleukin-6 production
IEA biological_process
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0042803 protein homodimerization
activity
IEA molecular_function
GO:0043185 vascular endothelial grow
th factor receptor 3 bind
ing
IEA molecular_function
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
IEA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0050930 induction of positive che
motaxis
IDA biological_process
GO:0051781 positive regulation of ce
ll division
IEA biological_process
GO:0060754 positive regulation of ma
st cell chemotaxis
IDA biological_process
GO:0070555 response to interleukin-1
IEA biological_process
GO:0071542 dopaminergic neuron diffe
rentiation
IEA biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0005161 platelet-derived growth f
actor receptor binding
TAS molecular_function
GO:0005172 vascular endothelial grow
th factor receptor bindin
g
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0050930 induction of positive che
motaxis
IDA biological_process
GO:0060754 positive regulation of ma
st cell chemotaxis
IDA biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa04933  AGE-RAGE signaling pathway in diabetic complications

Diseases

Associated diseases References
Endometrial cancer PMID: 20615255
Endometriosis PMID: 23585340
Gastric cancer KEGG: H00018
Endometriosis INFBASE23585340

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23585340 Endometrio
sis

79 (37 control,
42 endometrios
is)
NRP-1
NRP-2
VEGF-D
VEGF-C
Show abstract