Endometriosis Knowledgebase

Search Result

Gene id

2277

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

VEGFD Gene UCSC Ensembl

Aliases

FIGF, VEGF-D

Gene name

vascular endothelial growth factor D

Alternate names

vascular endothelial growth factor D, c-fos induced growth factor (vascular endothelial growth factor D),

Gene location

Xp22.2 (15384412: 15345590) Exons: 7 NC_000023.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus. [provided by RefSeq, Feb 2011]

OMIM

300091

Protein Summary

Protein general information

O43915

Name: Vascular endothelial growth factor D (VEGF D) (c Fos induced growth factor) (FIGF)

Length: 354 Mass: 40,444

Tissue specificity: Highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas.

Sequence

MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLRLKSFT
SMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEES
LICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPID
MLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP

Structural information

Interpro:	IPR029034 IPR023581 IPR000072
Prosite:	PS00249 PS50278
Pfam:	PF00341
CDD:	cd00135
PDB:	2XV7
PDBsum:	2XV7
STRING:	ENSP00000297904;

Other Databases

GeneCards: VEGFD; Malacards: VEGFD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005161	platelet-derived growth f actor receptor binding	TAS	molecular_function
GO:0005172	vascular endothelial grow th factor receptor bindin g	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0030947	regulation of vascular en dothelial growth factor r eceptor signaling pathway	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043185	vascular endothelial grow th factor receptor 3 bind ing	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0050930	induction of positive che motaxis	IDA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IDA	biological_process
GO:0070555	response to interleukin-1	IEA	biological_process
GO:0071542	dopaminergic neuron diffe rentiation	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005161	platelet-derived growth f actor receptor binding	TAS	molecular_function
GO:0005172	vascular endothelial grow th factor receptor bindin g	IEA	molecular_function
GO:0005172	vascular endothelial grow th factor receptor bindin g	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0030154	cell differentiation	IEA	biological_process
GO:0030947	regulation of vascular en dothelial growth factor r eceptor signaling pathway	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043185	vascular endothelial grow th factor receptor 3 bind ing	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0050930	induction of positive che motaxis	IDA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IDA	biological_process
GO:0070555	response to interleukin-1	IEA	biological_process
GO:0071542	dopaminergic neuron diffe rentiation	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005161	platelet-derived growth f actor receptor binding	TAS	molecular_function
GO:0005172	vascular endothelial grow th factor receptor bindin g	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050930	induction of positive che motaxis	IDA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa04933  AGE-RAGE signaling pathway in diabetic complications

Diseases

Associated diseases	References
Endometrial cancer	PMID: 20615255
Endometriosis	PMID: 23585340
Gastric cancer	KEGG: H00018
Endometriosis	INFBASE23585340

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23585340	Endometrio sis			79 (37 control, 42 endometrios is)		NRP-1 NRP-2 VEGF-D VEGF-C	Show abstract