Endometriosis Knowledgebase

Search Result

Gene id

22943

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DKK1 Gene UCSC Ensembl

Aliases

DKK-1, SK

Gene name

dickkopf WNT signaling pathway inhibitor 1

Alternate names

dickkopf-related protein 1, dickkopf 1 homolog, dickkopf-1 like, dickkopf-like protein 1, hDkk-1,

Gene location

10q21.1 (52314280: 52317656) Exons: 4 NC_000010.11

Gene summary(Entrez)

This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq, Jul 2008]

OMIM

605189

Protein Summary

Protein general information

O94907

Name: Dickkopf related protein 1 (Dickkopf 1) (Dkk 1) (hDkk 1) (SK)

Length: 266 Mass: 28,672

Tissue specificity: Placenta.

Sequence

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQ
TIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEI
EETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRR
KGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Structural information

Interpro:	IPR006796
Pfam:	PF04706
PDB:	3S2K 3S8V 3SOQ 5FWW 5GJE
PDBsum:	3S2K 3S8V 3SOQ 5FWW 5GJE
DIP:	46461
MINT:	1196808
STRING:	ENSP00000363081;

Other Databases

GeneCards: DKK1; Malacards: DKK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000904	cell morphogenesis involv ed in differentiation	IEA	biological_process
GO:0001706	endoderm formation	IEA	biological_process
GO:0001707	mesoderm formation	IEA	biological_process
GO:0001942	hair follicle development	IEA	biological_process
GO:0002090	regulation of receptor in ternalization	IDA	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0008083	growth factor activity	TAS	molecular_function
GO:0030178	negative regulation of Wn t signaling pathway	IDA	biological_process
GO:0030326	embryonic limb morphogene sis	IEA	biological_process
GO:0030514	negative regulation of BM P signaling pathway	IEA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032526	response to retinoic acid	IEA	biological_process
GO:0033137	negative regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0039706	co-receptor binding	TAS	molecular_function
GO:0042662	negative regulation of me sodermal cell fate specif ication	IDA	biological_process
GO:0042663	regulation of endodermal cell fate specification	IDA	biological_process
GO:0048019	receptor antagonist activ ity	IDA	molecular_function
GO:0048642	negative regulation of sk eletal muscle tissue deve lopment	IEA	biological_process
GO:0050750	low-density lipoprotein p article receptor binding	IDA	molecular_function
GO:0051964	negative regulation of sy napse assembly	TAS	biological_process
GO:0051966	regulation of synaptic tr ansmission, glutamatergic	IEA	biological_process
GO:0060325	face morphogenesis	IEA	biological_process
GO:0060394	negative regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0061743	motor learning	IEA	biological_process
GO:0090082	positive regulation of he art induction by negative regulation of canonical Wnt signaling pathway	ISS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IGI	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	NAS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090244	Wnt signaling pathway inv olved in somitogenesis	IEA	biological_process
GO:1900116	extracellular negative re gulation of signal transd uction	IEA	biological_process
GO:1901296	negative regulation of ca nonical Wnt signaling pat hway involved in cardiac muscle cell fate commitme nt	IDA	biological_process
GO:1904338	regulation of dopaminergi c neuron differentiation	TAS	biological_process
GO:1904693	midbrain morphogenesis	IEA	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IPI	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IDA	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IDA	biological_process
GO:2000726	negative regulation of ca rdiac muscle cell differe ntiation	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000904	cell morphogenesis involv ed in differentiation	IEA	biological_process
GO:0001706	endoderm formation	IEA	biological_process
GO:0001707	mesoderm formation	IEA	biological_process
GO:0001942	hair follicle development	IEA	biological_process
GO:0002090	regulation of receptor in ternalization	IDA	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007492	endoderm development	IEA	biological_process
GO:0008083	growth factor activity	TAS	molecular_function
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0030111	regulation of Wnt signali ng pathway	IEA	biological_process
GO:0030178	negative regulation of Wn t signaling pathway	IEA	biological_process
GO:0030178	negative regulation of Wn t signaling pathway	IEA	biological_process
GO:0030178	negative regulation of Wn t signaling pathway	IDA	biological_process
GO:0030326	embryonic limb morphogene sis	IEA	biological_process
GO:0030514	negative regulation of BM P signaling pathway	IEA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032526	response to retinoic acid	IEA	biological_process
GO:0033137	negative regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0039706	co-receptor binding	TAS	molecular_function
GO:0042662	negative regulation of me sodermal cell fate specif ication	IDA	biological_process
GO:0042663	regulation of endodermal cell fate specification	IDA	biological_process
GO:0048019	receptor antagonist activ ity	IDA	molecular_function
GO:0048642	negative regulation of sk eletal muscle tissue deve lopment	IEA	biological_process
GO:0050750	low-density lipoprotein p article receptor binding	IDA	molecular_function
GO:0050807	regulation of synapse org anization	IEA	biological_process
GO:0051964	negative regulation of sy napse assembly	TAS	biological_process
GO:0051966	regulation of synaptic tr ansmission, glutamatergic	IEA	biological_process
GO:0060323	head morphogenesis	IEA	biological_process
GO:0060325	face morphogenesis	IEA	biological_process
GO:0060394	negative regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0061743	motor learning	IEA	biological_process
GO:0090082	positive regulation of he art induction by negative regulation of canonical Wnt signaling pathway	IEA	biological_process
GO:0090082	positive regulation of he art induction by negative regulation of canonical Wnt signaling pathway	ISS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IGI	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	NAS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090244	Wnt signaling pathway inv olved in somitogenesis	IEA	biological_process
GO:1900116	extracellular negative re gulation of signal transd uction	IEA	biological_process
GO:1901296	negative regulation of ca nonical Wnt signaling pat hway involved in cardiac muscle cell fate commitme nt	IDA	biological_process
GO:1904338	regulation of dopaminergi c neuron differentiation	IEA	biological_process
GO:1904338	regulation of dopaminergi c neuron differentiation	TAS	biological_process
GO:1904693	midbrain morphogenesis	IEA	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IPI	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IDA	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IDA	biological_process
GO:2000726	negative regulation of ca rdiac muscle cell differe ntiation	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0002090	regulation of receptor in ternalization	IDA	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0008083	growth factor activity	TAS	molecular_function
GO:0030178	negative regulation of Wn t signaling pathway	IDA	biological_process
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0033137	negative regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0039706	co-receptor binding	TAS	molecular_function
GO:0042662	negative regulation of me sodermal cell fate specif ication	IDA	biological_process
GO:0042663	regulation of endodermal cell fate specification	IDA	biological_process
GO:0048019	receptor antagonist activ ity	IDA	molecular_function
GO:0050750	low-density lipoprotein p article receptor binding	IDA	molecular_function
GO:0051964	negative regulation of sy napse assembly	TAS	biological_process
GO:0060394	negative regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0090082	positive regulation of he art induction by negative regulation of canonical Wnt signaling pathway	ISS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IGI	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	NAS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:1901296	negative regulation of ca nonical Wnt signaling pat hway involved in cardiac muscle cell fate commitme nt	IDA	biological_process
GO:1904338	regulation of dopaminergi c neuron differentiation	TAS	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IPI	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IDA	biological_process
GO:1904723	negative regulation of Wn t-Frizzled-LRP5/6 complex assembly	IDA	biological_process
GO:2000726	negative regulation of ca rdiac muscle cell differe ntiation	IDA	biological_process

KEGG pathways

hsa04310 Wnt signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 17373700
Asthma	PMID: 19926868
Endometriosis	PMID: 12810542
Hyperandrogenism	PMID: 21611153
Implantation failure	PMID: 12810542
Polycystic ovary syndrome (PCOS)	PMID: 21611153
Female infertility	INFBASE12810542
Implantation defects	INFBASE12810542
Endometriosis	INFBASE12810542

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12810542	Endometrio sis					IL-15 proline-rich protein B61 Dickkopf-1 glycodelin N-acetylglucosamine-6-O-sulfotransferase G0S2 protein purine nucleoside phosphorylase semaphorin E neuronal olfactomedin-related endoplasmic reticulum localized protein mRNA Sam68-like phospho	Show abstract
22259059	Endometrio sis						Show abstract