Endometriosis Knowledgebase

Search Result

Gene id

2308

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FOXO1 Gene UCSC Ensembl

Aliases

FKH1, FKHR, FOXO1A

Gene name

forkhead box O1

Alternate names

forkhead box protein O1, forkhead box protein O1A, forkhead, Drosophila, homolog of, in rhabdomyosarcoma,

Gene location

13q14.11 (40666596: 40555663) Exons: 5 NC_000013.11

Gene summary(Entrez)

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq, Jul 2008]

OMIM

136533

Protein Summary

Protein general information

Q12778

Name: Forkhead box protein O1 (Forkhead box protein O1A) (Forkhead in rhabdomyosarcoma)

Length: 655 Mass: 69,662

Tissue specificity: Ubiquitous. {ECO

Sequence

MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLS
LLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPR
KSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIR
VQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLL
DNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYG
GMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHP
GHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Structural information

Motifs	Nuclear localization(251-253) Required for(462-466)
Interpro:	IPR001766 IPR032067 IPR032068 IPR030456 IPR011991
Prosite:	PS00658 PS50039
Pfam:	PF00250 PF16676 PF16675
PDB:	3CO6 3CO7 3COA 4LG0 5DUI
PDBsum:	3CO6 3CO7 3COA 4LG0 5DUI
DIP:	35654
STRING:	ENSP00000368880;

Other Databases

GeneCards: FOXO1; Malacards: FOXO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IBA	molecular_function
GO:0000989	transcription factor acti vity, transcription facto r binding	IEA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001223	transcription coactivator binding	IEA	molecular_function
GO:0001568	blood vessel development	IEA	biological_process
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0003682	chromatin binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	ISS	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006473	protein acetylation	ISS	biological_process
GO:0006914	autophagy	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological_process
GO:0008013	beta-catenin binding	IDA	molecular_function
GO:0008286	insulin receptor signalin g pathway	ISS	biological_process
GO:0009267	cellular response to star vation	IDA	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0010508	positive regulation of au tophagy	IMP	biological_process
GO:0031018	endocrine pancreas develo pment	TAS	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0032873	negative regulation of st ress-activated MAPK casca de	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	ISS	biological_process
GO:0035947	regulation of gluconeogen esis by regulation of tra nscription from RNA polym erase II promoter	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045444	fat cell differentiation	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045722	positive regulation of gl uconeogenesis	IEA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051721	protein phosphatase 2A bi nding	ISS	molecular_function
GO:0070166	enamel mineralization	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0070417	cellular response to cold	ISS	biological_process
GO:0071455	cellular response to hype roxia	IDA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0071732	cellular response to nitr ic oxide	ISS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0097150	neuronal stem cell popula tion maintenance	IEA	biological_process
GO:1902617	response to fluoride	IEA	biological_process
GO:2000177	regulation of neural prec ursor cell proliferation	IEA	biological_process
GO:2000377	regulation of reactive ox ygen species metabolic pr ocess	IEA	biological_process
GO:2000505	regulation of energy home ostasis	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IBA	molecular_function
GO:0000989	transcription factor acti vity, transcription facto r binding	IEA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001223	transcription coactivator binding	IEA	molecular_function
GO:0001227	transcriptional repressor activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IEA	molecular_function
GO:0001568	blood vessel development	IEA	biological_process
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	ISS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006473	protein acetylation	ISS	biological_process
GO:0006914	autophagy	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological_process
GO:0008013	beta-catenin binding	IDA	molecular_function
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008286	insulin receptor signalin g pathway	IEA	biological_process
GO:0008286	insulin receptor signalin g pathway	ISS	biological_process
GO:0009267	cellular response to star vation	IDA	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0010508	positive regulation of au tophagy	IMP	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0031018	endocrine pancreas develo pment	TAS	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032868	response to insulin	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0032873	negative regulation of st ress-activated MAPK casca de	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IEA	biological_process
GO:0034599	cellular response to oxid ative stress	ISS	biological_process
GO:0035947	regulation of gluconeogen esis by regulation of tra nscription from RNA polym erase II promoter	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045444	fat cell differentiation	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045722	positive regulation of gl uconeogenesis	IEA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051721	protein phosphatase 2A bi nding	IEA	molecular_function
GO:0051721	protein phosphatase 2A bi nding	ISS	molecular_function
GO:0070166	enamel mineralization	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0070417	cellular response to cold	ISS	biological_process
GO:0071455	cellular response to hype roxia	IDA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0071732	cellular response to nitr ic oxide	IEA	biological_process
GO:0071732	cellular response to nitr ic oxide	ISS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0097150	neuronal stem cell popula tion maintenance	IEA	biological_process
GO:1902617	response to fluoride	IEA	biological_process
GO:2000177	regulation of neural prec ursor cell proliferation	IEA	biological_process
GO:2000377	regulation of reactive ox ygen species metabolic pr ocess	IEA	biological_process
GO:2000505	regulation of energy home ostasis	ISS	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IBA	molecular_function
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0003682	chromatin binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	ISS	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006473	protein acetylation	ISS	biological_process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological_process
GO:0008013	beta-catenin binding	IDA	molecular_function
GO:0008286	insulin receptor signalin g pathway	ISS	biological_process
GO:0009267	cellular response to star vation	IDA	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0010508	positive regulation of au tophagy	IMP	biological_process
GO:0031018	endocrine pancreas develo pment	TAS	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0032873	negative regulation of st ress-activated MAPK casca de	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	ISS	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045444	fat cell differentiation	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051721	protein phosphatase 2A bi nding	ISS	molecular_function
GO:0070417	cellular response to cold	ISS	biological_process
GO:0071455	cellular response to hype roxia	IDA	biological_process
GO:0071732	cellular response to nitr ic oxide	ISS	biological_process
GO:2000505	regulation of energy home ostasis	ISS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05215  Prostate cancer
hsa04919  Thyroid hormone signaling pathway
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway
hsa04922  Glucagon signaling pathway
PTHR11829:SF159  CCKR signaling map

Diseases

Associated diseases	References
Alveolar rhabdomyosarcoma	KEGG: H00037
Autism	PMID: 19058789
Cryptorchidism	PMID: 24184258
Diabetes	PMID: 16497530
Endometrial decidualization	PMID: 16709600
Endometriosis	PMID: 15501904
Female infertility	PMID: 17640988
Hyperandrogenism	PMID: 28901488
Polycystic ovary syndrome (PCOS)	PMID: 20406953
Endometriosis	INFBASE15501904

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15501904	Endometrio sis			366 (157 contro l subjects, 209 patients with endometriosis)		FOXO1 c-jun	Show abstract
17510236	Endometrio sis					FOXO1A MIG6 and CYP26A1	Show abstract