Endometriosis Knowledgebase

Search Result

Gene id

23082

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PPRC1 Gene UCSC Ensembl

Aliases

PRC

Gene name

peroxisome proliferator-activated receptor gamma, coactivator-related 1

Alternate names

peroxisome proliferator-activated receptor gamma coactivator-related protein 1, PGC-1-related coactivator,

Gene location

10q24.32 (102132993: 102150332) Exons: 14 NC_000010.11

Gene summary(Entrez)

The protein encoded by this gene is similar to PPAR-gamma coactivator 1 (PPARGC1/PGC-1), a protein that can activate mitochondrial biogenesis in part through a direct interaction with nuclear respiratory factor 1 (NRF1). This protein has been shown to interact with NRF1. It is thought to be a functional relative of PPAR-gamma coactivator 1 that activates mitochondrial biogenesis through NRF1 in response to proliferative signals. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Protein Summary

Protein general information

Q5VV67

Name: Peroxisome proliferator activated receptor gamma coactivator related protein 1 (PGC 1 related coactivator) (PRC)

Length: 1664 Mass: 177,544

Tissue specificity: Strongly expressed in heart and skeletal muscle, moderately in lung, placenta, intestine, liver, kidney, spleen, thymus, colon and brain. Also expressed in several oncocytic thyroid tumors. {ECO

Sequence

MAARRGRRDGVAPPPSGGPGPDPGGGARGSGWGSRSQAPYGTLGAVSGGEQVLLHEEAGDSGFVSLSRLGPSLRD
KDLEMEELMLQDETLLGTMQSYMDASLISLIEDFGSLGESRLSLEDQNEVSLLTALTEILDNADSENLSPFDSIP
DSELLVSPREGSSLHKLLTLSRTPPERDLITPVDPLGPSTGSSRGSGVEMSLPDPSWDFSPPSFLETSSPKLPSW
RPPRSRPRWGQSPPPQQRSDGEEEEEVASFSGQILAGELDNCVSSIPDFPMHLACPEEEDKATAAEMAVPAAGDE
SISSLSELVRAMHPYCLPNLTHLASLEDELQEQPDDLTLPEGCVVLEIVGQAATAGDDLEIPVVVRQVSPGPRPV
LLDDSLETSSALQLLMPTLESETEAAVPKVTLCSEKEGLSLNSEEKLDSACLLKPREVVEPVVPKEPQNPPANAA
PGSQRARKGRKKKSKEQPAACVEGYARRLRSSSRGQSTVGTEVTSQVDNLQKQPQEELQKESGPLQGKGKPRAWA
RAWAAALENSSPKNLERSAGQSSPAKEGPLDLYPKLADTIQTNPIPTHLSLVDSAQASPMPVDSVEADPTAVGPV
LAGPVPVDPGLVDLASTSSELVEPLPAEPVLINPVLADSAAVDPAVVPISDNLPPVDAVPSGPAPVDLALVDPVP
NDLTPVDPVLVKSRPTDPRRGAVSSALGGSAPQLLVESESLDPPKTIIPEVKEVVDSLKIESGTSATTHEARPRP
LSLSEYRRRRQQRQAETEERSPQPPTGKWPSLPETPTGLADIPCLVIPPAPAKKTALQRSPETPLEICLVPVGPS
PASPSPEPPVSKPVASSPTEQVPSQEMPLLARPSPPVQSVSPAVPTPPSMSAALPFPAGGLGMPPSLPPPPLQPP
SLPLSMGPVLPDPFTHYAPLPSWPCYPHVSPSGYPCLPPPPTVPLVSGTPGAYAVPPTCSVPWAPPPAPVSPYSS
TCTYGPLGWGPGPQHAPFWSTVPPPPLPPASIGRAVPQPKMESRGTPAGPPENVLPLSMAPPLSLGLPGHGAPQT
EPTKVEVKPVPASPHPKHKVSALVQSPQMKALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPR
QSTVPKLPAVHPARLRKLSFLPTPRTQGSEDVVQAFISEIGIEASDLSSLLEQFEKSEAKKECPPPAPADSLAVG
NSGGVDIPQEKRPLDRLQAPELANVAGLTPPATPPHQLWKPLAAVSLLAKAKSPKSTAQEGTLKPEGVTEAKHPA
AVRLQEGVHGPSRVHVGSGDHDYCVRSRTPPKKMPALVIPEVGSRWNVKRHQDITIKPVLSLGPAAPPPPCIAAS
REPLDHRTSSEQADPSAPCLAPSSLLSPEASPCRNDMNTRTPPEPSAKQRSMRCYRKACRSASPSSQGWQGRRGR
NSRSVSSGSNRTSEASSSSSSSSSSSRSRSRSLSPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSSSSSSR
SRSRSPSPRRRSDRRRRYSSYRSHDHYQRQRVLQKERAIEERRVVFIGKIPGRMTRSELKQRFSVFGEIEECTIH
FRVQGDNYGFVTYRYAEEAFAAIESGHKLRQADEQPFDLCFGGRRQFCKRSYSDLDSNREDFDPAPVKSKFDSLD
FDTLLKQAQKNLRR

Structural information

Protein Domains	RRM. (1543-1619)
Interpro:	IPR034605 IPR034597 IPR000504
Prosite:	PS50102
Pfam:	PF00076
STRING:	ENSP00000278070;

Other Databases

GeneCards: PPRC1; Malacards: PPRC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001104	RNA polymerase II transcr iption cofactor activity	IBA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0007005	mitochondrion organizatio n	TAS	biological_process
GO:0008134	transcription factor bind ing	IBA	molecular_function
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IBA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IBA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001104	RNA polymerase II transcr iption cofactor activity	IBA	molecular_function
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003723	RNA binding	IEA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007005	mitochondrion organizatio n	TAS	biological_process
GO:0008134	transcription factor bind ing	IBA	molecular_function
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IBA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IBA	biological_process
GO:0001104	RNA polymerase II transcr iption cofactor activity	IBA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0007005	mitochondrion organizatio n	TAS	biological_process
GO:0008134	transcription factor bind ing	IBA	molecular_function
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IBA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IBA	biological_process

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 16385451
Diabetes	PMID: 19209188
Endometriosis	PMID: 3439444
Endometriosis	INFBASE3439444

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
3439444	Endometrio sis			14 patients wit h endometriosis	Female infertility	PRc Erc	Show abstract