Endometriosis Knowledgebase

Search Result

Gene id

2321

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FLT1 Gene UCSC Ensembl

Aliases

FLT, FLT-1, VEGFR-1, VEGFR1

Gene name

fms related tyrosine kinase 1

Alternate names

vascular endothelial growth factor receptor 1, fms-like tyrosine kinase 1, fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor), tyrosine-protein kinase FRT, tyrosine-protein kinase receptor FLT, vascular per,

Gene location

13q12.3 (28495127: 28300345) Exons: 33 NC_000013.11

Gene summary(Entrez)

This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.[provided by RefSeq, May 2009]

OMIM

165070

SNPs

rs9582036

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000675.2   g.28311271C>A
NC_000013.10   g.28885408C>A
NC_000013.11   g.28311271C>A
NG_012003.1   g.188858G>T
NM_002019.4   c.3635+319G>T

Protein Summary

Protein general information

P17948

Name: Vascular endothelial growth factor receptor 1 (VEGFR 1) (EC 2.7.10.1) (Fms like tyrosine kinase 1) (FLT 1) (Tyrosine protein kinase FRT) (Tyrosine protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)

Length: 1338 Mass: 150,769

Tissue specificity: Detected in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform 2 is strongly expressed

Sequence

MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLS
ITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTE
GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ
TNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLP
ATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ
ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVA
DSRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAIS
SSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGSVESSAYLTVQG
TSDKSNLELITLTCTCVAATLFWLLLTLFIRKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARE
RLKLGKSLGRGAFGKVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDK
SLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN
PDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYS
TPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTWTDSKPKASLKIDLRV
TSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCSPPPDYNSVVLYSTPPI

Structural information

Protein Domains	Ig-like (32-123) Ig-like (151-214) Ig-like (230-327) Ig-like (335-421) Ig-like (428-553) Ig-like (556-654) Ig-like (661-747) (827-)
Interpro:	IPR007110 IPR013783 IPR013098 IPR003599 IPR003598 IPR013106 IPR013151 IPR011009 IPR000719 IPR017441 IPR001245 IPR008266 IPR020635 IPR001824 IPR009135
Prosite:	PS50835 PS00107 PS50011 PS00109 PS00240
Pfam:	PF07679 PF00047 PF07714
PDB:	1FLT 1QSV 1QSZ 1QTY 1RV6 2XAC 3HNG 4CKV 4CL7 5ABD 5EX3 5T89
PDBsum:	1FLT 1QSV 1QSZ 1QTY 1RV6 2XAC 3HNG 4CKV 4CL7 5ABD 5EX3 5T89
DIP:	643
MINT:	127610
STRING:	ENSP00000282397;

Other Databases

GeneCards: FLT1; Malacards: FLT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activ ity	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005615	extracellular space	TAS	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006940	regulation of smooth musc le contraction	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0010863	positive regulation of ph ospholipase C activity	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0030154	cell differentiation	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030522	intracellular receptor si gnaling pathway	IEA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0036323	vascular endothelial grow th factor receptor-1 sign aling pathway	IDA	biological_process
GO:0036326	VEGF-A-activated receptor activity	IDA	molecular_function
GO:0036327	VEGF-B-activated receptor activity	IDA	molecular_function
GO:0036332	placental growth factor-a ctivated receptor activit y	IDA	molecular_function
GO:0038084	vascular endothelial grow th factor signaling pathw ay	IEA	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048514	blood vessel morphogenesi s	ISS	biological_process
GO:0048598	embryonic morphogenesis	ISS	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000186	activation of MAPKK activ ity	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006940	regulation of smooth musc le contraction	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0010863	positive regulation of ph ospholipase C activity	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IEA	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0030154	cell differentiation	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030522	intracellular receptor si gnaling pathway	IEA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0036323	vascular endothelial grow th factor receptor-1 sign aling pathway	IDA	biological_process
GO:0036326	VEGF-A-activated receptor activity	IDA	molecular_function
GO:0036327	VEGF-B-activated receptor activity	IDA	molecular_function
GO:0036332	placental growth factor-a ctivated receptor activit y	IDA	molecular_function
GO:0038084	vascular endothelial grow th factor signaling pathw ay	IEA	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048514	blood vessel morphogenesi s	ISS	biological_process
GO:0048598	embryonic morphogenesis	ISS	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0002548	monocyte chemotaxis	IDA	biological_process
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0010863	positive regulation of ph ospholipase C activity	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IDA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0036323	vascular endothelial grow th factor receptor-1 sign aling pathway	IDA	biological_process
GO:0036326	VEGF-A-activated receptor activity	IDA	molecular_function
GO:0036327	VEGF-B-activated receptor activity	IDA	molecular_function
GO:0036332	placental growth factor-a ctivated receptor activit y	IDA	molecular_function
GO:0043235	receptor complex	IDA	cellular_component
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048514	blood vessel morphogenesi s	ISS	biological_process
GO:0048598	embryonic morphogenesis	ISS	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa05202  Transcriptional misregulation in cancer
hsa04144  Endocytosis
hsa04066  HIF-1 signaling pathway
hsa05323  Rheumatoid arthritis

Diseases

Associated diseases	References
Cancer	PMID: 18636124
Endometrial cancer	PMID: 10831352
Endometriosis	PMID: 21733043
Hydrosalpinx	PMID: 14585871
Hypertensive pregnancy disorders	PMID: 23957293
Intrauterine growth retardation	PMID: 19658040
Male infertility	PMID: 10438994
Mullerian anomaly	PMID: 19200976
Neovascularization	PMID: 18975312
Polycystic ovary syndrome (PCOS)	PMID: 19330612
Preeclampsia	PMID: 18631405
Preeclampsia	PMID: 26116870
Pregnancy loss	PMID: 18779584
Tubal infertility	INFBASE21733043
Endometriosis	INFBASE16179118
Sarcoidosis	PMID: 19741061
Unexplained infertility	PMID: 18607827
Uterine anomalies	PMID: 19200976

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
16179118	Endometrio sis	157 (37 specime ns of entopic e ndometrium, 34 specimens of ov arian chocolate cyst, 34 speci mens of ovarian chocolate cyst , 15 specimens of red peritone al endometriosi s lesions, 4 ab dominal wall en dometriosis les ions, 33 patien ts with other g ynecological di		Show abstract
22230112	Endometrio sis		FLT1 VEGF	Show abstract
21733043	Endometrio sis	40 (20 women wi th endometriosi s III or IV, 20 with tubal inf ertility only ( control group) )		Show abstract