Endometriosis Knowledgebase

Search Result

Gene id

2335

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FN1 Gene UCSC Ensembl

Aliases

CIG, ED-B, FINC, FN, FNZ, GFND, GFND2, LETS, MSF

Gene name

fibronectin 1

Alternate names

fibronectin, cold-insoluble globulin, migration-stimulating factor,

Gene location

2q35 (215436166: 215360439) Exons: 47 NC_000002.12

Gene summary(Entrez)

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined. [provided by RefSeq, Jan 2016]

OMIM

135600

SNPs

rs1250248

Strand: +   Allele origin: unknown  Allele change: A/G   Mutation type: snp


NC_000002.12   g.215422370A>G
NC_000002.11   g.216287093A>G
NG_012196.1   g.18699T>C
NM_001306132.1   c.1394-127T>C
NM_001306131.1   c.1394-127T>C
NM_001306129.1   c.1394-127T>C
NM_001306130.1   c.1394-127T>C
NM_002026.3   c.1394-127T>C
NM_054034.2   c.1394-127T>C
NM_2124

Protein Summary

Protein general information

P02751

Name: Fibronectin (FN) (Cold insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl Y1; Ugl Y2; Ugl Y3]

Length: 2386 Mass: 262,625

Tissue specificity: Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl

Sequence

MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALV
CTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKI
GDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITC
TSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCT
TEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQ
NYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITY
NVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGV
VYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGF
RVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDT
SIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYF
KVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSK
YPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGG
EAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPAVPPPTDLRF
TNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPL
RGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYV
VSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVT
TTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKI
AWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAP
TDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLT
SRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQP
GTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTH
PGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP
HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEAL
KDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRW
CHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQ
RGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

Structural information

Protein Domains	Fibronectin (50-90) Fibronectin (95-138) Fibronectin (139-182) Fibronect (184-228)
Motifs	Cell attachment(1524-1526)
Interpro:	IPR000083 IPR003961 IPR000562 IPR013783 IPR013806
Prosite:	PS00022 PS01253 PS51091 PS00023 PS51092 PS50853
Pfam:	PF00039 PF00040 PF00041
CDD:	cd00062 cd00063
PDB:	1E88 1E8B 1FBR 1FNA 1FNF 1FNH 1J8K 1O9A 1OWW 1Q38 1QGB 1QO6 1TTF 1TTG 2CG6 2CG7 2CK2 2CKU 2EC3 2FN2 2FNB 2GEE 2H41 2H45 2HA1 2N1K 2OCF 2RKY 2RKZ 2RL0 3CAL 3EJH 3GXE 3M7P 3MQL 3R8Q 3T1W 3ZRZ 4GH7 4JE4 4JEG 4LXO 4MMX 4MMY 4MMZ 4PZ5 5DC0 5DC4 5DC9 5DFT 5J7C
PDBsum:	1E88 1E8B 1FBR 1FNA 1FNF 1FNH 1J8K 1O9A 1OWW 1Q38 1QGB 1QO6 1TTF 1TTG 2CG6 2CG7 2CK2 2CKU 2EC3 2FN2 2FNB 2GEE 2H41 2H45 2HA1 2N1K 2OCF 2RKY 2RKZ 2RL0 3CAL 3EJH 3GXE 3M7P 3MQL 3R8Q 3T1W 3ZRZ 4GH7 4JE4 4JEG 4LXO 4MMX 4MMY 4MMZ 4PZ5 5DC0 5DC4 5DC9 5DFT 5J7C
DIP:	29547
MINT:	1779779

Other Databases

GeneCards: FN1; Malacards: FN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0001775	cell activation	IEA	biological_process
GO:0001932	regulation of protein pho sphorylation	IDA	biological_process
GO:0002020	protease binding	IPI	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002931	response to ischemia	IEA	biological_process
GO:0005178	integrin binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	NAS	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005605	basal lamina	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005793	endoplasmic reticulum-Gol gi intermediate compartme nt	IDA	cellular_component
GO:0006953	acute-phase response	IEA	biological_process
GO:0007044	cell-substrate junction a ssembly	IEA	biological_process
GO:0007155	cell adhesion	NAS	biological_process
GO:0007161	calcium-independent cell- matrix adhesion	IEA	biological_process
GO:0008201	heparin binding	NAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008347	glial cell migration	IEA	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009611	response to wounding	NAS	biological_process
GO:0010193	response to ozone	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010952	positive regulation of pe ptidase activity	IEA	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016504	peptidase activator activ ity	IEA	molecular_function
GO:0018149	peptide cross-linking	IDA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0033622	integrin activation	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IEA	biological_process
GO:0035987	endodermal cell different iation	IDA	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0045340	mercury ion binding	IEA	molecular_function
GO:0045773	positive regulation of ax on extension	IEA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050921	positive regulation of ch emotaxis	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070372	regulation of ERK1 and ER K2 cascade	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071288	cellular response to merc ury ion	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0071773	cellular response to BMP stimulus	IEA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:1904237	positive regulation of su bstrate-dependent cell mi gration, cell attachment to substrate	IDA	biological_process
GO:2001202	negative regulation of tr ansforming growth factor- beta secretion	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0001525	angiogenesis	IEA	biological_process
GO:0001775	cell activation	IEA	biological_process
GO:0001932	regulation of protein pho sphorylation	IDA	biological_process
GO:0002020	protease binding	IEA	molecular_function
GO:0002020	protease binding	IPI	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002931	response to ischemia	IEA	biological_process
GO:0005178	integrin binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	NAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005605	basal lamina	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005793	endoplasmic reticulum-Gol gi intermediate compartme nt	IDA	cellular_component
GO:0006953	acute-phase response	IEA	biological_process
GO:0007044	cell-substrate junction a ssembly	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	NAS	biological_process
GO:0007160	cell-matrix adhesion	IEA	biological_process
GO:0007161	calcium-independent cell- matrix adhesion	IEA	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0008201	heparin binding	NAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008347	glial cell migration	IEA	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009611	response to wounding	IEA	biological_process
GO:0009611	response to wounding	NAS	biological_process
GO:0010193	response to ozone	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010952	positive regulation of pe ptidase activity	IEA	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016504	peptidase activator activ ity	IEA	molecular_function
GO:0018149	peptide cross-linking	IDA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0033622	integrin activation	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IEA	biological_process
GO:0035987	endodermal cell different iation	IDA	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0045340	mercury ion binding	IEA	molecular_function
GO:0045773	positive regulation of ax on extension	IEA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050921	positive regulation of ch emotaxis	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070372	regulation of ERK1 and ER K2 cascade	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071288	cellular response to merc ury ion	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071380	cellular response to pros taglandin E stimulus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0071773	cellular response to BMP stimulus	IEA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:1904237	positive regulation of su bstrate-dependent cell mi gration, cell attachment to substrate	IDA	biological_process
GO:2001202	negative regulation of tr ansforming growth factor- beta secretion	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0001932	regulation of protein pho sphorylation	IDA	biological_process
GO:0002020	protease binding	IPI	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005178	integrin binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	NAS	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005577	fibrinogen complex	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005793	endoplasmic reticulum-Gol gi intermediate compartme nt	IDA	cellular_component
GO:0007155	cell adhesion	NAS	biological_process
GO:0008201	heparin binding	NAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009611	response to wounding	NAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0018149	peptide cross-linking	IDA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0033622	integrin activation	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IMP	biological_process
GO:0035987	endodermal cell different iation	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070372	regulation of ERK1 and ER K2 cascade	IDA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:1904237	positive regulation of su bstrate-dependent cell mi gration, cell attachment to substrate	IDA	biological_process
GO:2001202	negative regulation of tr ansforming growth factor- beta secretion	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04510  Focal adhesion
hsa04810  Regulation of actin cytoskeleton
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05146  Amoebiasis
hsa05222  Small cell lung cancer
hsa04512  ECM-receptor interaction
hsa05100  Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Asthenozoospermia	PMID: 21848911
Cancer	PMID: 19730683
Coronary artery disease	PMID: 16375583
Cryoglobulinemia	PMID: 18810851
Endometriosis	PMID: 9022601
Glomerulopathy	KEGG: H01260, OMIM: 135600
Leucocytospermia	PMID: 23920130
Male infertility	PMID: 7639343
Nephrolithiasis	PMID: 19616291
Plasma fibronectin deficiency	OMIM: 135600
Female infertility	INFBASE11841847
Endometriosis	INFBASE11841847
Schizophrenia	PMID: 12497612
Systemic sclerosis	PMID: 9870923

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23142796	Endometrio sis	CDKN2BAS rs1333049, rs7521902 close to WNT4, rs12700667 in an inter-genic region on 7p15.2 and fibronectin 1 rs1250248		3015 (305 endom etriosis patien ts and 2710 con trols)		CDKN2BAS WNT4 fibronectin 1	Show abstract
11841847	Endometrio sis				Female infertility	Collagen IV (C-IV) elastin CD4 CD8 CD29 CD45RO and fibronectin (Fn)	Show abstract
24676469	Endometrio sis	rs12700667, rs7521902, rs10859871, rs1537377, rs7739264, rs13394619, rs1250248, rs4141819, rs4141819 and rs6734792	Austral ia, Bel gium, I taly, U K, USA, Japan	44184 (11 506 c ases, 32 678 co ntrols)	Female infertility		Show abstract
23315067	Endometrio sis	rs1250248, rs12700667, rs7798431 and rs7521902	Caucasi an	1960 (1129 pati ents with endom etriosis, 831 c ontrols)			Show abstract