Endometriosis Knowledgebase

Search Result

Gene id

23405

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

DICER1 Gene UCSC Ensembl

Aliases

DCR1, Dicer, Dicer1e, HERNA, K12H4.8-LIKE, MNG1, RMSE2

Gene name

dicer 1, ribonuclease III

Alternate names

endoribonuclease Dicer, Dicer1, Dcr-1 homolog, dicer 1, double-stranded RNA-specific endoribonuclease, dicer 1, ribonuclease type III, helicase MOI, helicase with RNAse motif,

Gene location

14q32.13 (95158009: 95086227) Exons: 36 NC_000014.9

Gene summary(Entrez)

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010]

OMIM

606241

Protein Summary

Protein general information

Q9UPY3

Name: Endoribonuclease Dicer (EC 3.1.26.3) (Helicase with RNase motif) (Helicase MOI)

Length: 1922 Mass: 218,682

Sequence

MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAV
LLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIM
TCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQK
LEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTP
KVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVER
RYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEG
VDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETD
IDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPL
RASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYP
KAIPECLRDSYPRPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEV
TISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDI
EKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTK
YNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRK
AVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHS
TIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN
QLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAVMPGTTDTIQVLKGRM
DSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKK
VSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEE
SLMWRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFED
FDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCG
ERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMF
DHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPR
QHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEE
DIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYD
GKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS

Structural information

Protein Domains	Helicase (51-227) Helicase (433-602) Dicer (630-722) PAZ (891-1042)
Motifs	DECH box.(175-178)
Interpro:	IPR011545 IPR005034 IPR014720 IPR014001 IPR001650 IPR027417 IPR003100 IPR000999
Prosite:	PS51327 PS50137 PS51192 PS51194 PS50821 PS00517 PS50142
Pfam:	PF00270 PF03368 PF00271 PF02170 PF00636
CDD:	cd00593
PDB:	2EB1 4NGB 4NGC 4NGD 4NGF 4NGG 4NH3 4NH5 4NH6 4NHA 4WYQ
PDBsum:	2EB1 4NGB 4NGC 4NGD 4NGF 4NGG 4NH3 4NH5 4NH6 4NHA 4WYQ
DIP:	29664
MINT:	1957525
STRING:	ENSP00000343745;

Other Databases

GeneCards: DICER1; Malacards: DICER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IMP	molecular_function
GO:0004386	helicase activity	IEA	molecular_function
GO:0004521	endoribonuclease activity	IMP	molecular_function
GO:0004521	endoribonuclease activity	IMP	molecular_function
GO:0004521	endoribonuclease activity	TAS	molecular_function
GO:0004521	endoribonuclease activity	IDA	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	IDA	molecular_function
GO:0004525	ribonuclease III activity	IDA	molecular_function
GO:0004530	deoxyribonuclease I activ ity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005793	endoplasmic reticulum-Gol gi intermediate compartme nt	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006309	apoptotic DNA fragmentati on	IBA	biological_process
GO:0010626	negative regulation of Sc hwann cell proliferation	ISS	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	ISS	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	ISS	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0021675	nerve development	ISS	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030423	targeting of mRNA for des truction involved in RNA interference	IMP	biological_process
GO:0030423	targeting of mRNA for des truction involved in RNA interference	IMP	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030425	dendrite	IEA	cellular_component
GO:0030426	growth cone	IEA	cellular_component
GO:0031047	gene silencing by RNA	TAS	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031643	positive regulation of my elination	ISS	biological_process
GO:0031643	positive regulation of my elination	ISS	biological_process
GO:0032290	peripheral nervous system myelin formation	ISS	biological_process
GO:0033167	ARC complex	IC	cellular_component
GO:0033168	conversion of ds siRNA to ss siRNA involved in RNA interference	IMP	biological_process
GO:0035087	siRNA loading onto RISC i nvolved in RNA interferen ce	IDA	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	ISS	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	IDA	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	IDA	biological_process
GO:0035197	siRNA binding	IDA	molecular_function
GO:0035280	miRNA loading onto RISC i nvolved in gene silencing by miRNA	IDA	biological_process
GO:0036404	conversion of ds siRNA to ss siRNA	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048812	neuron projection morphog enesis	ISS	biological_process
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0090502	RNA phosphodiester bond h ydrolysis, endonucleolyti c	IDA	biological_process
GO:0090502	RNA phosphodiester bond h ydrolysis, endonucleolyti c	IDA	biological_process
GO:0016442	RISC complex	IDA	cellular_component
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003723	RNA binding	IEA	molecular_function
GO:0003723	RNA binding	IEA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IMP	molecular_function
GO:0004386	helicase activity	IEA	molecular_function
GO:0004518	nuclease activity	IEA	molecular_function
GO:0004519	endonuclease activity	IEA	molecular_function
GO:0004521	endoribonuclease activity	IMP	molecular_function
GO:0004521	endoribonuclease activity	IMP	molecular_function
GO:0004521	endoribonuclease activity	TAS	molecular_function
GO:0004521	endoribonuclease activity	IDA	molecular_function
GO:0004525	ribonuclease III activity	IEA	molecular_function
GO:0004525	ribonuclease III activity	IEA	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	IDA	molecular_function
GO:0004525	ribonuclease III activity	IDA	molecular_function
GO:0004530	deoxyribonuclease I activ ity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005793	endoplasmic reticulum-Gol gi intermediate compartme nt	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006309	apoptotic DNA fragmentati on	IBA	biological_process
GO:0006396	RNA processing	IEA	biological_process
GO:0010626	negative regulation of Sc hwann cell proliferation	ISS	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	ISS	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	ISS	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0016891	endoribonuclease activity , producing 5'-phosphomon oesters	IEA	molecular_function
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0021675	nerve development	ISS	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030423	targeting of mRNA for des truction involved in RNA interference	IMP	biological_process
GO:0030423	targeting of mRNA for des truction involved in RNA interference	IMP	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030425	dendrite	IEA	cellular_component
GO:0030426	growth cone	IEA	cellular_component
GO:0031047	gene silencing by RNA	IEA	biological_process
GO:0031047	gene silencing by RNA	TAS	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031643	positive regulation of my elination	ISS	biological_process
GO:0031643	positive regulation of my elination	ISS	biological_process
GO:0032290	peripheral nervous system myelin formation	ISS	biological_process
GO:0033167	ARC complex	IC	cellular_component
GO:0033168	conversion of ds siRNA to ss siRNA involved in RNA interference	IMP	biological_process
GO:0035087	siRNA loading onto RISC i nvolved in RNA interferen ce	IDA	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	ISS	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	IDA	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	IDA	biological_process
GO:0035197	siRNA binding	IDA	molecular_function
GO:0035280	miRNA loading onto RISC i nvolved in gene silencing by miRNA	IDA	biological_process
GO:0036404	conversion of ds siRNA to ss siRNA	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048812	neuron projection morphog enesis	ISS	biological_process
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0090502	RNA phosphodiester bond h ydrolysis, endonucleolyti c	IDA	biological_process
GO:0090502	RNA phosphodiester bond h ydrolysis, endonucleolyti c	IDA	biological_process
GO:0016442	RISC complex	IDA	cellular_component
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IMP	molecular_function
GO:0004521	endoribonuclease activity	IMP	molecular_function
GO:0004521	endoribonuclease activity	IMP	molecular_function
GO:0004521	endoribonuclease activity	TAS	molecular_function
GO:0004521	endoribonuclease activity	IDA	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	EXP	molecular_function
GO:0004525	ribonuclease III activity	IDA	molecular_function
GO:0004525	ribonuclease III activity	IDA	molecular_function
GO:0004530	deoxyribonuclease I activ ity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006309	apoptotic DNA fragmentati on	IBA	biological_process
GO:0010626	negative regulation of Sc hwann cell proliferation	ISS	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	ISS	biological_process
GO:0014040	positive regulation of Sc hwann cell differentiatio n	ISS	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0021675	nerve development	ISS	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030423	targeting of mRNA for des truction involved in RNA interference	IMP	biological_process
GO:0030423	targeting of mRNA for des truction involved in RNA interference	IMP	biological_process
GO:0031047	gene silencing by RNA	TAS	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031054	pre-miRNA processing	IDA	biological_process
GO:0031643	positive regulation of my elination	ISS	biological_process
GO:0031643	positive regulation of my elination	ISS	biological_process
GO:0032290	peripheral nervous system myelin formation	ISS	biological_process
GO:0033167	ARC complex	IC	cellular_component
GO:0033168	conversion of ds siRNA to ss siRNA involved in RNA interference	IMP	biological_process
GO:0035087	siRNA loading onto RISC i nvolved in RNA interferen ce	IDA	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	ISS	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	IDA	biological_process
GO:0035196	production of miRNAs invo lved in gene silencing by miRNA	IDA	biological_process
GO:0035197	siRNA binding	IDA	molecular_function
GO:0035280	miRNA loading onto RISC i nvolved in gene silencing by miRNA	IDA	biological_process
GO:0036404	conversion of ds siRNA to ss siRNA	IMP	biological_process
GO:0048812	neuron projection morphog enesis	ISS	biological_process
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070578	RISC-loading complex	IDA	cellular_component
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0070883	pre-miRNA binding	IDA	molecular_function
GO:0090502	RNA phosphodiester bond h ydrolysis, endonucleolyti c	IDA	biological_process
GO:0090502	RNA phosphodiester bond h ydrolysis, endonucleolyti c	IDA	biological_process
GO:0016442	RISC complex	IDA	cellular_component
GO:0070883	pre-miRNA binding	IDA	molecular_function

KEGG pathways

hsa05206 MicroRNAs in cancer

Diseases

Associated diseases	References
Azoospermia	PMID: 27264823
Cancer	PMID: 19138993
Endometriosis	PMID: 21063030
Idiopathic male infertility	PMID: 22381205
Pleuropulmonary blastoma	OMIM: 606241
Primary ovarian insufficiency (POI)	PMID: 23549446
Endometriosis	INFBASE21063030
Rhabdomyosarcoma	OMIM: 606241

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21063030	Endometrio sis			63 (19 mild and 44 severe endo metriosis)		EGFR MIR21 DICER1	Show abstract