Endometriosis Knowledgebase

Search Result

Gene id

23411

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SIRT1 Gene UCSC Ensembl

Aliases

SIR2, SIR2L1, SIR2alpha

Gene name

sirtuin 1

Alternate names

NAD-dependent protein deacetylase sirtuin-1, SIR2-like protein 1, regulatory protein SIR2 homolog 1, sirtuin type 1,

Gene location

10q21.3 (67884668: 67918389) Exons: 11 NC_000010.11

Gene summary(Entrez)

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008]

OMIM

604479

Protein Summary

Protein general information

Q96EB6

Name: NAD dependent protein deacetylase sirtuin 1 (hSIRT1) (EC 3.5.1. ) (Regulatory protein SIR2 homolog 1) (SIR2 like protein 1) (hSIR2) [Cleaved into: SirtT1 75 kDa fragment (75SirT1)]

Length: 747 Mass: 81,681

Tissue specificity: Widely expressed. {ECO

Sequence

MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAAL
WREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGD
EIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVI
NILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICK
YKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVAL
IPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLS
ELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNS
DSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS

Structural information

Protein Domains	Deacetylase (244-498)
Motifs	Nuclear localization(32-39) Nuclear export(138-145) Nuclear localization(223-230) Nuclear export(425-431)
Interpro:	IPR029035 IPR003000 IPR026590
Prosite:	PS50305
Pfam:	PF02146
PDB:	4I5I 4IF6 4IG9 4KXQ 4ZZH 4ZZI 4ZZJ 5BTR
PDBsum:	4I5I 4IF6 4IG9 4KXQ 4ZZH 4ZZI 4ZZJ 5BTR
DIP:	29757
MINT:	3052322
STRING:	ENSP00000212015;

Other Databases

GeneCards: SIRT1; Malacards: SIRT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000012	single strand break repai r	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000183	chromatin silencing at rD NA	IDA	biological_process
GO:0000183	chromatin silencing at rD NA	TAS	biological_process
GO:0000720	pyrimidine dimer repair b y nucleotide-excision rep air	IMP	biological_process
GO:0000731	DNA synthesis involved in DNA repair	ISS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0001046	core promoter sequence-sp ecific DNA binding	IEA	molecular_function
GO:0001525	angiogenesis	IDA	biological_process
GO:0001542	ovulation from ovarian fo llicle	IEA	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0002039	p53 binding	IPI	molecular_function
GO:0002821	positive regulation of ad aptive immune response	IDA	biological_process
GO:0003714	transcription corepressor activity	ISS	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	EXP	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005637	nuclear inner membrane	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005677	chromatin silencing compl ex	IDA	cellular_component
GO:0005719	nuclear euchromatin	IDA	cellular_component
GO:0005720	nuclear heterochromatin	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006281	DNA repair	TAS	biological_process
GO:0006325	chromatin organization	IMP	biological_process
GO:0006342	chromatin silencing	TAS	biological_process
GO:0006343	establishment of chromati n silencing	IDA	biological_process
GO:0006344	maintenance of chromatin silencing	IMP	biological_process
GO:0006346	methylation-dependent chr omatin silencing	TAS	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006364	rRNA processing	IEA	biological_process
GO:0006476	protein deacetylation	IMP	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IMP	biological_process
GO:0006642	triglyceride mobilization	ISS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006979	response to oxidative str ess	IDA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007346	regulation of mitotic cel l cycle	IDA	biological_process
GO:0007517	muscle organ development	IEA	biological_process
GO:0007569	cell aging	TAS	biological_process
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010875	positive regulation of ch olesterol efflux	ISS	biological_process
GO:0010883	regulation of lipid stora ge	ISS	biological_process
GO:0010906	regulation of glucose met abolic process	ISS	biological_process
GO:0010934	macrophage cytokine produ ction	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016239	positive regulation of ma croautophagy	IDA	biological_process
GO:0016567	protein ubiquitination	IMP	biological_process
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016605	PML body	IDA	cellular_component
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0018394	peptidyl-lysine acetylati on	IMP	biological_process
GO:0019213	deacetylase activity	IDA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030225	macrophage differentiatio n	ISS	biological_process
GO:0030308	negative regulation of ce ll growth	IMP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	ISS	biological_process
GO:0031393	negative regulation of pr ostaglandin biosynthetic process	ISS	biological_process
GO:0031648	protein destabilization	ISS	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0031937	positive regulation of ch romatin silencing	IMP	biological_process
GO:0032007	negative regulation of TO R signaling	IMP	biological_process
GO:0032071	regulation of endodeoxyri bonuclease activity	IMP	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032868	response to insulin	ISS	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0032922	circadian regulation of g ene expression	IMP	biological_process
GO:0033158	regulation of protein imp ort into nucleus, translo cation	IMP	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033553	rDNA heterochromatin	IDA	cellular_component
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0034391	regulation of smooth musc le cell apoptotic process	ISS	biological_process
GO:0034979	NAD-dependent protein dea cetylase activity	IMP	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	TAS	molecular_function
GO:0034983	peptidyl-lysine deacetyla tion	IDA	biological_process
GO:0035257	nuclear hormone receptor binding	IPI	molecular_function
GO:0035356	cellular triglyceride hom eostasis	ISS	biological_process
GO:0035358	regulation of peroxisome proliferator activated re ceptor signaling pathway	ISS	biological_process
GO:0042127	regulation of cell prolif eration	IMP	biological_process
GO:0042326	negative regulation of ph osphorylation	IMP	biological_process
GO:0042393	histone binding	IPI	molecular_function
GO:0042393	histone binding	IPI	molecular_function
GO:0042542	response to hydrogen pero xide	IDA	biological_process
GO:0042595	behavioral response to st arvation	IEA	biological_process
GO:0042632	cholesterol homeostasis	ISS	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IMP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	IMP	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043398	HLH domain binding	IPI	molecular_function
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044321	response to leptin	ISS	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IDA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046969	NAD-dependent histone dea cetylase activity (H3-K9 specific)	ISS	molecular_function
GO:0050872	white fat cell differenti ation	ISS	biological_process
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular_function
GO:0051097	negative regulation of he licase activity	IDA	biological_process
GO:0051574	positive regulation of hi stone H3-K9 methylation	IMP	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IMP	biological_process
GO:0055089	fatty acid homeostasis	ISS	biological_process
GO:0060766	negative regulation of an drogen receptor signaling pathway	IMP	biological_process
GO:0061647	histone H3-K9 modificatio n	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070403	NAD+ binding	IEA	molecular_function
GO:0070857	regulation of bile acid b iosynthetic process	ISS	biological_process
GO:0070914	UV-damage excision repair	IMP	biological_process
GO:0070932	histone H3 deacetylation	IMP	biological_process
GO:0070932	histone H3 deacetylation	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071441	negative regulation of hi stone H3-K14 acetylation	IMP	biological_process
GO:0071456	cellular response to hypo xia	IMP	biological_process
GO:0071479	cellular response to ioni zing radiation	ISS	biological_process
GO:0071900	regulation of protein ser ine/threonine kinase acti vity	IMP	biological_process
GO:0090335	regulation of brown fat c ell differentiation	ISS	biological_process
GO:0090400	stress-induced premature senescence	IMP	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1901984	negative regulation of pr otein acetylation	IMP	biological_process
GO:1901984	negative regulation of pr otein acetylation	IMP	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	ISS	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:1902237	positive regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	IEA	biological_process
GO:1904179	positive regulation of ad ipose tissue development	ISS	biological_process
GO:1990254	keratin filament binding	IPI	molecular_function
GO:1990619	histone H3-K9 deacetylati on	IEA	biological_process
GO:2000111	positive regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000480	negative regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IMP	biological_process
GO:2000619	negative regulation of hi stone H4-K16 acetylation	IMP	biological_process
GO:2000655	negative regulation of ce llular response to testos terone stimulus	IMP	biological_process
GO:2000757	negative regulation of pe ptidyl-lysine acetylation	IDA	biological_process
GO:2000773	negative regulation of ce llular senescence	IDA	biological_process
GO:2000774	positive regulation of ce llular senescence	IDA	biological_process
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006471	protein ADP-ribosylation	TAS	biological_process
GO:0035098	ESC/E(Z) complex	IDA	cellular_component
GO:0000012	single strand break repai r	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000183	chromatin silencing at rD NA	IDA	biological_process
GO:0000183	chromatin silencing at rD NA	TAS	biological_process
GO:0000720	pyrimidine dimer repair b y nucleotide-excision rep air	IEA	biological_process
GO:0000720	pyrimidine dimer repair b y nucleotide-excision rep air	IMP	biological_process
GO:0000731	DNA synthesis involved in DNA repair	IEA	biological_process
GO:0000731	DNA synthesis involved in DNA repair	ISS	biological_process
GO:0000785	chromatin	IEA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0001046	core promoter sequence-sp ecific DNA binding	IEA	molecular_function
GO:0001525	angiogenesis	IDA	biological_process
GO:0001542	ovulation from ovarian fo llicle	IEA	biological_process
GO:0001678	cellular glucose homeosta sis	IEA	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0002039	p53 binding	IEA	molecular_function
GO:0002039	p53 binding	IPI	molecular_function
GO:0002821	positive regulation of ad aptive immune response	IDA	biological_process
GO:0003714	transcription corepressor activity	IEA	molecular_function
GO:0003714	transcription corepressor activity	ISS	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	EXP	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005637	nuclear inner membrane	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005677	chromatin silencing compl ex	IDA	cellular_component
GO:0005719	nuclear euchromatin	IDA	cellular_component
GO:0005720	nuclear heterochromatin	IEA	cellular_component
GO:0005720	nuclear heterochromatin	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006281	DNA repair	TAS	biological_process
GO:0006325	chromatin organization	IMP	biological_process
GO:0006342	chromatin silencing	TAS	biological_process
GO:0006343	establishment of chromati n silencing	IDA	biological_process
GO:0006344	maintenance of chromatin silencing	IMP	biological_process
GO:0006346	methylation-dependent chr omatin silencing	TAS	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006364	rRNA processing	IEA	biological_process
GO:0006476	protein deacetylation	IEA	biological_process
GO:0006476	protein deacetylation	IMP	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IMP	biological_process
GO:0006642	triglyceride mobilization	IEA	biological_process
GO:0006642	triglyceride mobilization	ISS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006979	response to oxidative str ess	IDA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007346	regulation of mitotic cel l cycle	IDA	biological_process
GO:0007517	muscle organ development	IEA	biological_process
GO:0007569	cell aging	TAS	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0009267	cellular response to star vation	IEA	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010875	positive regulation of ch olesterol efflux	IEA	biological_process
GO:0010875	positive regulation of ch olesterol efflux	ISS	biological_process
GO:0010883	regulation of lipid stora ge	ISS	biological_process
GO:0010906	regulation of glucose met abolic process	IEA	biological_process
GO:0010906	regulation of glucose met abolic process	ISS	biological_process
GO:0010934	macrophage cytokine produ ction	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016239	positive regulation of ma croautophagy	IEA	biological_process
GO:0016239	positive regulation of ma croautophagy	IDA	biological_process
GO:0016567	protein ubiquitination	IMP	biological_process
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0016575	histone deacetylation	IEA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016605	PML body	IEA	cellular_component
GO:0016605	PML body	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IEA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0018394	peptidyl-lysine acetylati on	IMP	biological_process
GO:0019213	deacetylase activity	IEA	molecular_function
GO:0019213	deacetylase activity	IDA	molecular_function
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0030154	cell differentiation	IEA	biological_process
GO:0030225	macrophage differentiatio n	ISS	biological_process
GO:0030308	negative regulation of ce ll growth	IMP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IEA	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	ISS	biological_process
GO:0031393	negative regulation of pr ostaglandin biosynthetic process	IEA	biological_process
GO:0031393	negative regulation of pr ostaglandin biosynthetic process	ISS	biological_process
GO:0031648	protein destabilization	IEA	biological_process
GO:0031648	protein destabilization	ISS	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0031937	positive regulation of ch romatin silencing	IMP	biological_process
GO:0032007	negative regulation of TO R signaling	IEA	biological_process
GO:0032007	negative regulation of TO R signaling	IMP	biological_process
GO:0032071	regulation of endodeoxyri bonuclease activity	IMP	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032868	response to insulin	ISS	biological_process
GO:0032922	circadian regulation of g ene expression	IEA	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0032922	circadian regulation of g ene expression	IMP	biological_process
GO:0033158	regulation of protein imp ort into nucleus, translo cation	IMP	biological_process
GO:0033210	leptin-mediated signaling pathway	IEA	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033553	rDNA heterochromatin	IDA	cellular_component
GO:0033558	protein deacetylase activ ity	IEA	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0034391	regulation of smooth musc le cell apoptotic process	IEA	biological_process
GO:0034391	regulation of smooth musc le cell apoptotic process	ISS	biological_process
GO:0034979	NAD-dependent protein dea cetylase activity	IEA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IMP	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	TAS	molecular_function
GO:0034983	peptidyl-lysine deacetyla tion	IDA	biological_process
GO:0035257	nuclear hormone receptor binding	IPI	molecular_function
GO:0035356	cellular triglyceride hom eostasis	IEA	biological_process
GO:0035356	cellular triglyceride hom eostasis	ISS	biological_process
GO:0035358	regulation of peroxisome proliferator activated re ceptor signaling pathway	IEA	biological_process
GO:0035358	regulation of peroxisome proliferator activated re ceptor signaling pathway	ISS	biological_process
GO:0042127	regulation of cell prolif eration	IMP	biological_process
GO:0042326	negative regulation of ph osphorylation	IEA	biological_process
GO:0042326	negative regulation of ph osphorylation	IMP	biological_process
GO:0042393	histone binding	IPI	molecular_function
GO:0042393	histone binding	IPI	molecular_function
GO:0042542	response to hydrogen pero xide	IDA	biological_process
GO:0042595	behavioral response to st arvation	IEA	biological_process
GO:0042632	cholesterol homeostasis	IEA	biological_process
GO:0042632	cholesterol homeostasis	ISS	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IMP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	IMP	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043398	HLH domain binding	IPI	molecular_function
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044321	response to leptin	IEA	biological_process
GO:0044321	response to leptin	ISS	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IDA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046969	NAD-dependent histone dea cetylase activity (H3-K9 specific)	IEA	molecular_function
GO:0046969	NAD-dependent histone dea cetylase activity (H3-K9 specific)	ISS	molecular_function
GO:0048511	rhythmic process	IEA	biological_process
GO:0050872	white fat cell differenti ation	IEA	biological_process
GO:0050872	white fat cell differenti ation	ISS	biological_process
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular_function
GO:0051097	negative regulation of he licase activity	IDA	biological_process
GO:0051574	positive regulation of hi stone H3-K9 methylation	IMP	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IEA	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IMP	biological_process
GO:0055089	fatty acid homeostasis	IEA	biological_process
GO:0055089	fatty acid homeostasis	ISS	biological_process
GO:0060766	negative regulation of an drogen receptor signaling pathway	IMP	biological_process
GO:0061647	histone H3-K9 modificatio n	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070403	NAD+ binding	IEA	molecular_function
GO:0070857	regulation of bile acid b iosynthetic process	IEA	biological_process
GO:0070857	regulation of bile acid b iosynthetic process	ISS	biological_process
GO:0070914	UV-damage excision repair	IMP	biological_process
GO:0070932	histone H3 deacetylation	IMP	biological_process
GO:0070932	histone H3 deacetylation	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071441	negative regulation of hi stone H3-K14 acetylation	IMP	biological_process
GO:0071456	cellular response to hypo xia	IMP	biological_process
GO:0071479	cellular response to ioni zing radiation	IEA	biological_process
GO:0071479	cellular response to ioni zing radiation	ISS	biological_process
GO:0071900	regulation of protein ser ine/threonine kinase acti vity	IMP	biological_process
GO:0090335	regulation of brown fat c ell differentiation	IEA	biological_process
GO:0090335	regulation of brown fat c ell differentiation	ISS	biological_process
GO:0090400	stress-induced premature senescence	IMP	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1901984	negative regulation of pr otein acetylation	IMP	biological_process
GO:1901984	negative regulation of pr otein acetylation	IMP	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IEA	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	ISS	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:1902237	positive regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	IEA	biological_process
GO:1904179	positive regulation of ad ipose tissue development	ISS	biological_process
GO:1990254	keratin filament binding	IPI	molecular_function
GO:1990619	histone H3-K9 deacetylati on	IEA	biological_process
GO:2000111	positive regulation of ma crophage apoptotic proces s	IEA	biological_process
GO:2000111	positive regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000480	negative regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IEA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IMP	biological_process
GO:2000619	negative regulation of hi stone H4-K16 acetylation	IMP	biological_process
GO:2000655	negative regulation of ce llular response to testos terone stimulus	IMP	biological_process
GO:2000757	negative regulation of pe ptidyl-lysine acetylation	IDA	biological_process
GO:2000773	negative regulation of ce llular senescence	IDA	biological_process
GO:2000774	positive regulation of ce llular senescence	IDA	biological_process
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006471	protein ADP-ribosylation	TAS	biological_process
GO:0035098	ESC/E(Z) complex	IDA	cellular_component
GO:0000012	single strand break repai r	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000183	chromatin silencing at rD NA	IDA	biological_process
GO:0000183	chromatin silencing at rD NA	TAS	biological_process
GO:0000720	pyrimidine dimer repair b y nucleotide-excision rep air	IMP	biological_process
GO:0000731	DNA synthesis involved in DNA repair	ISS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0001525	angiogenesis	IDA	biological_process
GO:0001678	cellular glucose homeosta sis	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0002039	p53 binding	IPI	molecular_function
GO:0002821	positive regulation of ad aptive immune response	IDA	biological_process
GO:0003714	transcription corepressor activity	ISS	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	EXP	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005637	nuclear inner membrane	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005677	chromatin silencing compl ex	IDA	cellular_component
GO:0005719	nuclear euchromatin	IDA	cellular_component
GO:0005720	nuclear heterochromatin	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006281	DNA repair	TAS	biological_process
GO:0006325	chromatin organization	IMP	biological_process
GO:0006342	chromatin silencing	TAS	biological_process
GO:0006343	establishment of chromati n silencing	IDA	biological_process
GO:0006344	maintenance of chromatin silencing	IMP	biological_process
GO:0006346	methylation-dependent chr omatin silencing	TAS	biological_process
GO:0006476	protein deacetylation	IMP	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0006476	protein deacetylation	IMP	biological_process
GO:0006642	triglyceride mobilization	ISS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006979	response to oxidative str ess	IDA	biological_process
GO:0007346	regulation of mitotic cel l cycle	IDA	biological_process
GO:0007569	cell aging	TAS	biological_process
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010875	positive regulation of ch olesterol efflux	ISS	biological_process
GO:0010883	regulation of lipid stora ge	ISS	biological_process
GO:0010906	regulation of glucose met abolic process	ISS	biological_process
GO:0010934	macrophage cytokine produ ction	ISS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	ISS	biological_process
GO:0016239	positive regulation of ma croautophagy	IDA	biological_process
GO:0016567	protein ubiquitination	IMP	biological_process
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016575	histone deacetylation	IDA	biological_process
GO:0016605	PML body	IDA	cellular_component
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0017136	NAD-dependent histone dea cetylase activity	IDA	molecular_function
GO:0018394	peptidyl-lysine acetylati on	IMP	biological_process
GO:0019213	deacetylase activity	IDA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030225	macrophage differentiatio n	ISS	biological_process
GO:0030308	negative regulation of ce ll growth	IMP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	ISS	biological_process
GO:0031393	negative regulation of pr ostaglandin biosynthetic process	ISS	biological_process
GO:0031648	protein destabilization	ISS	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0031937	positive regulation of ch romatin silencing	IMP	biological_process
GO:0032007	negative regulation of TO R signaling	IMP	biological_process
GO:0032071	regulation of endodeoxyri bonuclease activity	IMP	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0032868	response to insulin	ISS	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0032922	circadian regulation of g ene expression	IMP	biological_process
GO:0033158	regulation of protein imp ort into nucleus, translo cation	IMP	biological_process
GO:0033210	leptin-mediated signaling pathway	ISS	biological_process
GO:0033553	rDNA heterochromatin	IDA	cellular_component
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0034391	regulation of smooth musc le cell apoptotic process	ISS	biological_process
GO:0034979	NAD-dependent protein dea cetylase activity	IMP	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	IDA	molecular_function
GO:0034979	NAD-dependent protein dea cetylase activity	TAS	molecular_function
GO:0034983	peptidyl-lysine deacetyla tion	IDA	biological_process
GO:0035257	nuclear hormone receptor binding	IPI	molecular_function
GO:0035356	cellular triglyceride hom eostasis	ISS	biological_process
GO:0035358	regulation of peroxisome proliferator activated re ceptor signaling pathway	ISS	biological_process
GO:0042127	regulation of cell prolif eration	IMP	biological_process
GO:0042326	negative regulation of ph osphorylation	IMP	biological_process
GO:0042393	histone binding	IPI	molecular_function
GO:0042393	histone binding	IPI	molecular_function
GO:0042542	response to hydrogen pero xide	IDA	biological_process
GO:0042632	cholesterol homeostasis	ISS	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IMP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	IMP	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043398	HLH domain binding	IPI	molecular_function
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044321	response to leptin	ISS	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IDA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IDA	biological_process
GO:0046969	NAD-dependent histone dea cetylase activity (H3-K9 specific)	ISS	molecular_function
GO:0050872	white fat cell differenti ation	ISS	biological_process
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular_function
GO:0051097	negative regulation of he licase activity	IDA	biological_process
GO:0051574	positive regulation of hi stone H3-K9 methylation	IMP	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IMP	biological_process
GO:0055089	fatty acid homeostasis	ISS	biological_process
GO:0060766	negative regulation of an drogen receptor signaling pathway	IMP	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070857	regulation of bile acid b iosynthetic process	ISS	biological_process
GO:0070914	UV-damage excision repair	IMP	biological_process
GO:0070932	histone H3 deacetylation	IMP	biological_process
GO:0070932	histone H3 deacetylation	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071441	negative regulation of hi stone H3-K14 acetylation	IMP	biological_process
GO:0071456	cellular response to hypo xia	IMP	biological_process
GO:0071479	cellular response to ioni zing radiation	ISS	biological_process
GO:0071900	regulation of protein ser ine/threonine kinase acti vity	IMP	biological_process
GO:0090335	regulation of brown fat c ell differentiation	ISS	biological_process
GO:0090400	stress-induced premature senescence	IMP	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901984	negative regulation of pr otein acetylation	IMP	biological_process
GO:1901984	negative regulation of pr otein acetylation	IMP	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	ISS	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:1904179	positive regulation of ad ipose tissue development	ISS	biological_process
GO:1990254	keratin filament binding	IPI	molecular_function
GO:2000111	positive regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000480	negative regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IMP	biological_process
GO:2000619	negative regulation of hi stone H4-K16 acetylation	IMP	biological_process
GO:2000655	negative regulation of ce llular response to testos terone stimulus	IMP	biological_process
GO:2000757	negative regulation of pe ptidyl-lysine acetylation	IDA	biological_process
GO:2000773	negative regulation of ce llular senescence	IDA	biological_process
GO:2000774	positive regulation of ce llular senescence	IDA	biological_process
GO:0003950	NAD+ ADP-ribosyltransfera se activity	TAS	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006471	protein ADP-ribosylation	TAS	biological_process
GO:0035098	ESC/E(Z) complex	IDA	cellular_component

KEGG pathways

hsa05206  MicroRNAs in cancer
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway
hsa04922  Glucagon signaling pathway
hsa05031  Amphetamine addiction

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 17373700
Cardiovascular disease	PMID: 17895433
Endometriosis	PMID: 23080547
Endometriosis	INFBASE23080547

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23080547	Endometrio sis			15 patients wit h endometriosis		SIRT1 HDAC1 SUV39H1 SUV39H2 HDAC2 G9a	Show abstract