Endometriosis Knowledgebase

Search Result

Gene id

2357

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FPR1 Gene UCSC Ensembl

Aliases

FMLP, FPR

Gene name

formyl peptide receptor 1

Alternate names

fMet-Leu-Phe receptor, N-formylpeptide chemoattractant receptor, fMLP receptor,

Gene location

19q13.41 (51751896: 51745769) Exons: 3 NC_000019.10

Gene summary(Entrez)

This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.[provided by RefSeq, Jul 2010]

OMIM

136537

Protein Summary

Protein general information

P21462

Name: fMet Leu Phe receptor (fMLP receptor) (N formyl peptide receptor) (FPR) (N formylpeptide chemoattractant receptor)

Length: 350 Mass: 38,446

Tissue specificity: Neutrophils.

Sequence

METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFT
STLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPW
VMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIA
TKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Structural information

Interpro:	IPR027345 IPR000826 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000302707;

Other Databases

GeneCards: FPR1; Malacards: FPR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular_function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005768	endosome	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007188	adenylate cyclase-modulat ing G-protein coupled rec eptor signaling pathway	TAS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0007263	nitric oxide mediated sig nal transduction	TAS	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0050786	RAGE receptor binding	IEA	molecular_function
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004982	N-formyl peptide receptor activity	IEA	molecular_function
GO:0004982	N-formyl peptide receptor activity	IEA	molecular_function
GO:0004982	N-formyl peptide receptor activity	TAS	molecular_function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular_function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005768	endosome	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007188	adenylate cyclase-modulat ing G-protein coupled rec eptor signaling pathway	TAS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IEA	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0007263	nitric oxide mediated sig nal transduction	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	TAS	cellular_component
GO:0050786	RAGE receptor binding	IEA	molecular_function
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004982	N-formyl peptide receptor activity	TAS	molecular_function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular_function
GO:0004982	N-formyl peptide receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005768	endosome	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007188	adenylate cyclase-modulat ing G-protein coupled rec eptor signaling pathway	TAS	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0007263	nitric oxide mediated sig nal transduction	TAS	biological_process
GO:0016021	integral component of mem brane	TAS	cellular_component

KEGG pathways

hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05150  Staphylococcus aureus infection

Diseases

Associated diseases	References
Endometriosis	PMID: 25201101
Inflammation	PMID: 16953235
Periodontitis	PMID: 12595898
Periodontitis	PMID: 17452560
Endometriosis	INFBASE25201101
Unexplained infertility	PMID: 24597237

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25201101	Endometrio sis			28 (18 women wi th abdominal wa ll endometriosi s,10 women with out endometrios is)		ANXA1 CMA1 FPR1 TPSAB1	Show abstract