Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 246778
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol IL27   Gene   UCSC   Ensembl
Aliases IL-27, IL-27A, IL27A, IL27p28, IL30, p28
Gene name interleukin 27
Alternate names interleukin-27 subunit alpha, IL-27 p28 subunit, IL-27 subunit alpha, IL-27-A, IL27-A, interleukin-30,
Gene location 16p12.1-p11.2 (28526729: 28499361)     Exons: 6     NC_000016.10
Gene summary(Entrez) The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR). [provided by RefSeq, Jul 2008]
OMIM 608273

Protein Summary

Protein general information Q8NEV9  

Name: Interleukin-27 subunit alpha (IL-27 subunit alpha) (IL-27-A) (IL27-A) (Interleukin-30) (p28)

Length: 243  Mass: 27,493

Tissue specificity: Expressed in monocytes and in placenta. {ECO

Sequence MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPG
VNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRH
LRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLS
KAGHSVWPLGFPTLSPQP
Structural information
Interpro:  IPR026207

DIP:  
59473
STRING:   ENSP00000349365;
Other Databases GeneCards:  IL27;  Malacards:  IL27

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005102 receptor binding
ISS molecular_function
GO:0005125 cytokine activity
IEA molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
ISS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0006954 inflammatory response
IEA biological_process
GO:0009617 response to bacterium
IEA biological_process
GO:0042129 regulation of T cell prol
iferation
ISS biological_process
GO:0042129 regulation of T cell prol
iferation
IBA biological_process
GO:0045078 positive regulation of in
terferon-gamma biosynthet
ic process
IDA biological_process
GO:0045087 innate immune response
IEA biological_process
GO:0045523 interleukin-27 receptor b
inding
ISS molecular_function
GO:0045523 interleukin-27 receptor b
inding
IBA molecular_function
GO:0045625 regulation of T-helper 1
cell differentiation
IDA biological_process
GO:0050688 regulation of defense res
ponse to virus
IEA biological_process
GO:0002376 immune system process
IEA biological_process
GO:0005102 receptor binding
IEA molecular_function
GO:0005102 receptor binding
ISS molecular_function
GO:0005125 cytokine activity
IEA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
ISS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006954 inflammatory response
IEA biological_process
GO:0009617 response to bacterium
IEA biological_process
GO:0042129 regulation of T cell prol
iferation
IEA biological_process
GO:0042129 regulation of T cell prol
iferation
IEA biological_process
GO:0042129 regulation of T cell prol
iferation
ISS biological_process
GO:0042129 regulation of T cell prol
iferation
IBA biological_process
GO:0045078 positive regulation of in
terferon-gamma biosynthet
ic process
IDA biological_process
GO:0045087 innate immune response
IEA biological_process
GO:0045523 interleukin-27 receptor b
inding
IEA molecular_function
GO:0045523 interleukin-27 receptor b
inding
IEA molecular_function
GO:0045523 interleukin-27 receptor b
inding
ISS molecular_function
GO:0045523 interleukin-27 receptor b
inding
IBA molecular_function
GO:0045625 regulation of T-helper 1
cell differentiation
IDA biological_process
GO:0050688 regulation of defense res
ponse to virus
IEA biological_process
GO:0005102 receptor binding
ISS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
ISS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0042129 regulation of T cell prol
iferation
ISS biological_process
GO:0042129 regulation of T cell prol
iferation
IBA biological_process
GO:0045078 positive regulation of in
terferon-gamma biosynthet
ic process
IDA biological_process
GO:0045523 interleukin-27 receptor b
inding
ISS molecular_function
GO:0045523 interleukin-27 receptor b
inding
IBA molecular_function
GO:0045625 regulation of T-helper 1
cell differentiation
IDA biological_process

Diseases

Associated diseases References
Endometriosis INFBASE28300844

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28300844 Endometrio
sis


IL10
IL27
IL6 and TGFB1
Show abstract