Endometriosis Knowledgebase

Search Result

Gene id

246778

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL27 Gene UCSC Ensembl

Aliases

IL-27, IL-27A, IL27A, IL27p28, IL30, p28

Gene name

interleukin 27

Alternate names

interleukin-27 subunit alpha, IL-27 p28 subunit, IL-27 subunit alpha, IL-27-A, IL27-A, interleukin-30,

Gene location

16p12.1-p11.2 (28526729: 28499361) Exons: 6 NC_000016.10

Gene summary(Entrez)

The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR). [provided by RefSeq, Jul 2008]

OMIM

608273

Protein Summary

Protein general information

Q8NEV9

Name: Interleukin-27 subunit alpha (IL-27 subunit alpha) (IL-27-A) (IL27-A) (Interleukin-30) (p28)

Length: 243 Mass: 27,493

Tissue specificity: Expressed in monocytes and in placenta. {ECO

Sequence

MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPG
VNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRH
LRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLS
KAGHSVWPLGFPTLSPQP

Structural information

Interpro:	IPR026207
DIP:	59473
STRING:	ENSP00000349365;

Other Databases

GeneCards: IL27; Malacards: IL27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	receptor binding	ISS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0009617	response to bacterium	IEA	biological_process
GO:0042129	regulation of T cell prol iferation	ISS	biological_process
GO:0042129	regulation of T cell prol iferation	IBA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045523	interleukin-27 receptor b inding	ISS	molecular_function
GO:0045523	interleukin-27 receptor b inding	IBA	molecular_function
GO:0045625	regulation of T-helper 1 cell differentiation	IDA	biological_process
GO:0050688	regulation of defense res ponse to virus	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005102	receptor binding	ISS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0009617	response to bacterium	IEA	biological_process
GO:0042129	regulation of T cell prol iferation	IEA	biological_process
GO:0042129	regulation of T cell prol iferation	IEA	biological_process
GO:0042129	regulation of T cell prol iferation	ISS	biological_process
GO:0042129	regulation of T cell prol iferation	IBA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045523	interleukin-27 receptor b inding	IEA	molecular_function
GO:0045523	interleukin-27 receptor b inding	IEA	molecular_function
GO:0045523	interleukin-27 receptor b inding	ISS	molecular_function
GO:0045523	interleukin-27 receptor b inding	IBA	molecular_function
GO:0045625	regulation of T-helper 1 cell differentiation	IDA	biological_process
GO:0050688	regulation of defense res ponse to virus	IEA	biological_process
GO:0005102	receptor binding	ISS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0042129	regulation of T cell prol iferation	ISS	biological_process
GO:0042129	regulation of T cell prol iferation	IBA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045523	interleukin-27 receptor b inding	ISS	molecular_function
GO:0045523	interleukin-27 receptor b inding	IBA	molecular_function
GO:0045625	regulation of T-helper 1 cell differentiation	IDA	biological_process

Diseases

Associated diseases	References
Endometriosis	INFBASE28300844

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28300844	Endometrio sis					IL10 IL27 IL6 and TGFB1	Show abstract