Endometriosis Knowledgebase

Search Result

Gene id

2475

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MTOR Gene UCSC Ensembl

Aliases

FRAP, FRAP1, FRAP2, RAFT1, RAPT1, SKS

Gene name

mechanistic target of rapamycin

Alternate names

serine/threonine-protein kinase mTOR, FK506 binding protein 12-rapamycin associated protein 2, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP-rapamycin associated protein, FKBP12-rapamycin complex-associated protein 1, mammalian target o,

Gene location

1p36.22 (11262550: 11106530) Exons: 59 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. [provided by RefSeq, Sep 2008]

OMIM

601231

Protein Summary

Protein general information

P42345

Name: Serine/threonine protein kinase mTOR (EC 2.7.11.1) (FK506 binding protein 12 rapamycin complex associated protein 1) (FKBP12 rapamycin complex associated protein) (Mammalian target of rapamycin) (mTOR) (Mechanistic target of rapamycin) (Rapamycin and FKBP

Length: 2549 Mass: 288,892

Tissue specificity: Expressed in numerous tissues, with highest levels in testis. {ECO

Sequence

MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFELV
SSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVK
RALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREP
KEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQ
WVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKV
YLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLS
RQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
LASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIK
EQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIM
DMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAI
TFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQS
TIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAP
EAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRV
SKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDI
AEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQ
PEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAEL
TAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDM
RTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQ
QQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSK
TLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPR
PLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHE
MWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLM
GSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALI
RDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLA
VMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTV
PESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW

Structural information

Protein Domains	FAT. (1382-1982) PI3K/PI4K. (2182-2516) FATC. (2517-2549)
Interpro:	IPR011989 IPR016024 IPR024585 IPR003152 IPR009076 IPR011009 IPR000403 IPR018936 IPR003151 IPR014009 IPR026683
Prosite:	PS51189 PS51190 PS00915 PS00916 PS50290
Pfam:	PF11865 PF02259 PF02260 PF08771 PF00454
PDB:	1AUE 1FAP 1NSG 2FAP 2GAQ 2NPU 2RSE 3FAP 3JBZ 4DRH 4DRI 4DRJ 4FAP 4JSN 4JSP 4JSV 4JSX 4JT5 4JT6 5FLC 5GPG 5H64
PDBsum:	1AUE 1FAP 1NSG 2FAP 2GAQ 2NPU 2RSE 3FAP 3JBZ 4DRH 4DRI 4DRJ 4FAP 4JSN 4JSP 4JSV 4JSX 4JT5 4JT6 5FLC 5GPG 5H64
DIP:	790
MINT:	121301
STRING:	ENSP00000354558;

Other Databases

GeneCards: MTOR; Malacards: MTOR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0001030	RNA polymerase III type 1 promoter DNA binding	IDA	molecular_function
GO:0001031	RNA polymerase III type 2 promoter DNA binding	IDA	molecular_function
GO:0001032	RNA polymerase III type 3 promoter DNA binding	IDA	molecular_function
GO:0001156	TFIIIC-class transcriptio n factor binding	IDA	molecular_function
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IEA	biological_process
GO:0003007	heart morphogenesis	IEA	biological_process
GO:0003179	heart valve morphogenesis	IEA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	NAS	cellular_component
GO:0005979	regulation of glycogen bi osynthetic process	IEA	biological_process
GO:0006112	energy reserve metabolic process	IEA	biological_process
GO:0006207	'de novo' pyrimidine nucl eobase biosynthetic proce ss	IEA	biological_process
GO:0006281	DNA repair	IBA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006950	response to stress	IMP	biological_process
GO:0007050	cell cycle arrest	TAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007569	cell aging	IEA	biological_process
GO:0007584	response to nutrient	NAS	biological_process
GO:0007616	long-term memory	IEA	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0010507	negative regulation of au tophagy	ISS	biological_process
GO:0010592	positive regulation of la mellipodium assembly	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010831	positive regulation of my otube differentiation	IEA	biological_process
GO:0012505	endomembrane system	IDA	cellular_component
GO:0014042	positive regulation of ne uron maturation	IEA	biological_process
GO:0014736	negative regulation of mu scle atrophy	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016049	cell growth	TAS	biological_process
GO:0016049	cell growth	IDA	biological_process
GO:0016236	macroautophagy	TAS	biological_process
GO:0016242	negative regulation of ma croautophagy	IEA	biological_process
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016310	phosphorylation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IMP	biological_process
GO:0018105	peptidyl-serine phosphory lation	IMP	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IEA	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0021510	spinal cord development	IEA	biological_process
GO:0030163	protein catabolic process	TAS	biological_process
GO:0030425	dendrite	IEA	cellular_component
GO:0030838	positive regulation of ac tin filament polymerizati on	IEA	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IEA	biological_process
GO:0031529	ruffle organization	IEA	biological_process
GO:0031641	regulation of myelination	IEA	biological_process
GO:0031669	cellular response to nutr ient levels	ISS	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IMP	cellular_component
GO:0031932	TORC2 complex	IDA	cellular_component
GO:0031932	TORC2 complex	IDA	cellular_component
GO:0031998	regulation of fatty acid beta-oxidation	IEA	biological_process
GO:0032095	regulation of response to food	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032956	regulation of actin cytos keleton organization	IMP	biological_process
GO:0035176	social behavior	IEA	biological_process
GO:0035264	multicellular organism gr owth	IEA	biological_process
GO:0040007	growth	NAS	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042220	response to cocaine	IEA	biological_process
GO:0043022	ribosome binding	IEA	molecular_function
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043087	regulation of GTPase acti vity	IEA	biological_process
GO:0043200	response to amino acid	IDA	biological_process
GO:0043278	response to morphine	IEA	biological_process
GO:0043610	regulation of carbohydrat e utilization	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045670	regulation of osteoclast differentiation	ISS	biological_process
GO:0045727	positive regulation of tr anslation	IDA	biological_process
GO:0045792	negative regulation of ce ll size	IEA	biological_process
GO:0045859	regulation of protein kin ase activity	IEA	biological_process
GO:0045945	positive regulation of tr anscription from RNA poly merase III promoter	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046889	positive regulation of li pid biosynthetic process	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048255	mRNA stabilization	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050882	voluntary musculoskeletal movement	IEA	biological_process
GO:0051219	phosphoprotein binding	IPI	molecular_function
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051534	negative regulation of NF AT protein import into nu cleus	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0055013	cardiac muscle cell devel opment	IEA	biological_process
GO:0060048	cardiac muscle contractio n	IEA	biological_process
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0060252	positive regulation of gl ial cell proliferation	IEA	biological_process
GO:0060999	positive regulation of de ndritic spine development	IEA	biological_process
GO:0061051	positive regulation of ce ll growth involved in car diac muscle cell developm ent	IEA	biological_process
GO:0071456	cellular response to hypo xia	ISS	biological_process
GO:0090335	regulation of brown fat c ell differentiation	IEA	biological_process
GO:0090559	regulation of membrane pe rmeability	IEA	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901216	positive regulation of ne uron death	IEA	biological_process
GO:1901838	positive regulation of tr anscription of nuclear la rge rRNA transcript from RNA polymerase I promoter	IMP	biological_process
GO:1904000	positive regulation of ea ting behavior	IEA	biological_process
GO:1904056	positive regulation of ch olangiocyte proliferation	IEA	biological_process
GO:1904058	positive regulation of se nsory perception of pain	IEA	biological_process
GO:1904193	negative regulation of ch olangiocyte apoptotic pro cess	IEA	biological_process
GO:1904197	positive regulation of gr anulosa cell proliferatio n	IEA	biological_process
GO:1904206	positive regulation of sk eletal muscle hypertrophy	IEA	biological_process
GO:1904213	negative regulation of io dide transmembrane transp ort	IEA	biological_process
GO:0016605	PML body	ISS	cellular_component
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001030	RNA polymerase III type 1 promoter DNA binding	IDA	molecular_function
GO:0001031	RNA polymerase III type 2 promoter DNA binding	IDA	molecular_function
GO:0001032	RNA polymerase III type 3 promoter DNA binding	IDA	molecular_function
GO:0001156	TFIIIC-class transcriptio n factor binding	IDA	molecular_function
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IEA	biological_process
GO:0003007	heart morphogenesis	IEA	biological_process
GO:0003179	heart valve morphogenesis	IEA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IBA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	NAS	cellular_component
GO:0005979	regulation of glycogen bi osynthetic process	IEA	biological_process
GO:0006109	regulation of carbohydrat e metabolic process	IEA	biological_process
GO:0006112	energy reserve metabolic process	IEA	biological_process
GO:0006207	'de novo' pyrimidine nucl eobase biosynthetic proce ss	IEA	biological_process
GO:0006281	DNA repair	IBA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006950	response to stress	IMP	biological_process
GO:0007050	cell cycle arrest	TAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007569	cell aging	IEA	biological_process
GO:0007584	response to nutrient	NAS	biological_process
GO:0007616	long-term memory	IEA	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0010507	negative regulation of au tophagy	IEA	biological_process
GO:0010507	negative regulation of au tophagy	ISS	biological_process
GO:0010592	positive regulation of la mellipodium assembly	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010831	positive regulation of my otube differentiation	IEA	biological_process
GO:0010942	positive regulation of ce ll death	IEA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0012505	endomembrane system	IDA	cellular_component
GO:0014042	positive regulation of ne uron maturation	IEA	biological_process
GO:0014736	negative regulation of mu scle atrophy	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016049	cell growth	TAS	biological_process
GO:0016049	cell growth	IDA	biological_process
GO:0016236	macroautophagy	TAS	biological_process
GO:0016242	negative regulation of ma croautophagy	IEA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016310	phosphorylation	IDA	biological_process
GO:0016605	PML body	IEA	cellular_component
GO:0016605	PML body	IEA	cellular_component
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IMP	biological_process
GO:0018105	peptidyl-serine phosphory lation	IMP	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IEA	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0021510	spinal cord development	IEA	biological_process
GO:0030030	cell projection organizat ion	IEA	biological_process
GO:0030163	protein catabolic process	TAS	biological_process
GO:0030425	dendrite	IEA	cellular_component
GO:0030838	positive regulation of ac tin filament polymerizati on	IEA	biological_process
GO:0031090	organelle membrane	IEA	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IEA	biological_process
GO:0031529	ruffle organization	IEA	biological_process
GO:0031641	regulation of myelination	IEA	biological_process
GO:0031669	cellular response to nutr ient levels	IEA	biological_process
GO:0031669	cellular response to nutr ient levels	ISS	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031931	TORC1 complex	IEA	cellular_component
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IMP	cellular_component
GO:0031932	TORC2 complex	IDA	cellular_component
GO:0031932	TORC2 complex	IDA	cellular_component
GO:0031998	regulation of fatty acid beta-oxidation	IEA	biological_process
GO:0032095	regulation of response to food	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032956	regulation of actin cytos keleton organization	IMP	biological_process
GO:0032991	macromolecular complex	IEA	cellular_component
GO:0035176	social behavior	IEA	biological_process
GO:0035264	multicellular organism gr owth	IEA	biological_process
GO:0040007	growth	NAS	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042220	response to cocaine	IEA	biological_process
GO:0043022	ribosome binding	IEA	molecular_function
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043087	regulation of GTPase acti vity	IEA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043200	response to amino acid	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043278	response to morphine	IEA	biological_process
GO:0043610	regulation of carbohydrat e utilization	IEA	biological_process
GO:0044877	macromolecular complex bi nding	IEA	molecular_function
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045670	regulation of osteoclast differentiation	IEA	biological_process
GO:0045670	regulation of osteoclast differentiation	ISS	biological_process
GO:0045727	positive regulation of tr anslation	IEA	biological_process
GO:0045727	positive regulation of tr anslation	IDA	biological_process
GO:0045792	negative regulation of ce ll size	IEA	biological_process
GO:0045859	regulation of protein kin ase activity	IEA	biological_process
GO:0045945	positive regulation of tr anscription from RNA poly merase III promoter	IMP	biological_process
GO:0046777	protein autophosphorylati on	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046889	positive regulation of li pid biosynthetic process	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048255	mRNA stabilization	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0048738	cardiac muscle tissue dev elopment	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050769	positive regulation of ne urogenesis	IEA	biological_process
GO:0050882	voluntary musculoskeletal movement	IEA	biological_process
GO:0051219	phosphoprotein binding	IPI	molecular_function
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051534	negative regulation of NF AT protein import into nu cleus	IEA	biological_process
GO:0051896	regulation of protein kin ase B signaling	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0055006	cardiac cell development	IEA	biological_process
GO:0055013	cardiac muscle cell devel opment	IEA	biological_process
GO:0060048	cardiac muscle contractio n	IEA	biological_process
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0060252	positive regulation of gl ial cell proliferation	IEA	biological_process
GO:0060999	positive regulation of de ndritic spine development	IEA	biological_process
GO:0061051	positive regulation of ce ll growth involved in car diac muscle cell developm ent	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071456	cellular response to hypo xia	ISS	biological_process
GO:0090335	regulation of brown fat c ell differentiation	IEA	biological_process
GO:0090559	regulation of membrane pe rmeability	IEA	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901216	positive regulation of ne uron death	IEA	biological_process
GO:1901838	positive regulation of tr anscription of nuclear la rge rRNA transcript from RNA polymerase I promoter	IMP	biological_process
GO:1904000	positive regulation of ea ting behavior	IEA	biological_process
GO:1904056	positive regulation of ch olangiocyte proliferation	IEA	biological_process
GO:1904058	positive regulation of se nsory perception of pain	IEA	biological_process
GO:1904193	negative regulation of ch olangiocyte apoptotic pro cess	IEA	biological_process
GO:1904197	positive regulation of gr anulosa cell proliferatio n	IEA	biological_process
GO:1904206	positive regulation of sk eletal muscle hypertrophy	IEA	biological_process
GO:1904213	negative regulation of io dide transmembrane transp ort	IEA	biological_process
GO:0016605	PML body	ISS	cellular_component
GO:0001030	RNA polymerase III type 1 promoter DNA binding	IDA	molecular_function
GO:0001031	RNA polymerase III type 2 promoter DNA binding	IDA	molecular_function
GO:0001032	RNA polymerase III type 3 promoter DNA binding	IDA	molecular_function
GO:0001156	TFIIIC-class transcriptio n factor binding	IDA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005942	phosphatidylinositol 3-ki nase complex	NAS	cellular_component
GO:0006281	DNA repair	IBA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006950	response to stress	IMP	biological_process
GO:0007050	cell cycle arrest	TAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0007584	response to nutrient	NAS	biological_process
GO:0010507	negative regulation of au tophagy	ISS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0012505	endomembrane system	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016049	cell growth	TAS	biological_process
GO:0016049	cell growth	IDA	biological_process
GO:0016236	macroautophagy	TAS	biological_process
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016310	phosphorylation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IMP	biological_process
GO:0018105	peptidyl-serine phosphory lation	IMP	biological_process
GO:0030163	protein catabolic process	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031669	cellular response to nutr ient levels	ISS	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031929	TOR signaling	IMP	biological_process
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IDA	cellular_component
GO:0031931	TORC1 complex	IMP	cellular_component
GO:0031932	TORC2 complex	IDA	cellular_component
GO:0031932	TORC2 complex	IDA	cellular_component
GO:0032956	regulation of actin cytos keleton organization	IMP	biological_process
GO:0040007	growth	NAS	biological_process
GO:0043200	response to amino acid	IDA	biological_process
GO:0045670	regulation of osteoclast differentiation	ISS	biological_process
GO:0045727	positive regulation of tr anslation	IDA	biological_process
GO:0045945	positive regulation of tr anscription from RNA poly merase III promoter	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046889	positive regulation of li pid biosynthetic process	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0051219	phosphoprotein binding	IPI	molecular_function
GO:0071456	cellular response to hypo xia	ISS	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1901838	positive regulation of tr anscription of nuclear la rge rRNA transcript from RNA polymerase I promoter	IMP	biological_process
GO:0016605	PML body	ISS	cellular_component

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05224  Breast cancer
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04919  Thyroid hormone signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04371  Apelin signaling pathway
hsa04152  AMPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa04150  mTOR signaling pathway
hsa04931  Insulin resistance
hsa04211  Longevity regulating pathway
hsa05230  Central carbon metabolism in cancer
hsa04140  Autophagy - animal
hsa04920  Adipocytokine signaling pathway
hsa05231  Choline metabolism in cancer
hsa04213  Longevity regulating pathway
hsa05214  Glioma
hsa05221  Acute myeloid leukemia
hsa04930  Type II diabetes mellitus
hsa04136  Autophagy - other
PTHR11139:SF9  Interleukin signaling pathway
PTHR11139:SF9  Interleukin signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Cancer	PMID: 19164214
Endometriosis	PMID: 25721338
Focal cortical dysplasia	OMIM: 601231
Non-obstructive azoospermia (NOA)	PMID: 19210773
Endometriosis	INFBASE25721338
Polycystic ovary syndrome (PCOS)	PMID: 19574280
Smith-Kingsmore syndrome	OMIM: 601231
Spermatogenetic defects	PMID: 26209830

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25721338	Endometrio sis			95 (17 healthy non-menopausal women, 48 patie nts with ovaria n endometriotic cysts, 30 with adenomyosis or normal endomet ria)		DJ- p-mTOR	Show abstract