Endometriosis Knowledgebase

Search Result

Gene id

2534

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FYN Gene UCSC Ensembl

Aliases

SLK, SYN, p59-FYN

Gene name

FYN proto-oncogene, Src family tyrosine kinase

Alternate names

tyrosine-protein kinase Fyn, FYN oncogene related to SRC, FGR, YES, OKT3-induced calcium influx regulator, c-syn protooncogene, proto-oncogene Syn, proto-oncogene c-Fyn, src-like kinase, src/yes-related novel, tyrosine kinase p59fyn(T),

Gene location

6q21 (111873451: 111660331) Exons: 19 NC_000006.12

Gene summary(Entrez)

This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq, Jul 2008]

OMIM

137025

Protein Summary

Protein general information

P06241

Name: Tyrosine protein kinase Fyn (EC 2.7.10.2) (Proto oncogene Syn) (Proto oncogene c Fyn) (Src like kinase) (SLK) (p59 Fyn)

Length: 537 Mass: 60,762

Tissue specificity: Isoform 1 is highly expressed in the brain. Isoform 2 is expressed in cells of hemopoietic lineages, especially T-lymphocytes. {ECO

Sequence

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGT
LRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWY
FGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQ
QLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVA
AGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVW
SFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFT
ATEPQYQPGENL

Structural information

Protein Domains	SH3. (82-143) SH2. (149-246) Protein (271-524)
Interpro:	IPR011009 IPR000719 IPR017441 IPR001245 IPR000980 IPR001452 IPR008266 IPR020635
Prosite:	PS00107 PS50011 PS00109 PS50001 PS50002
Pfam:	PF07714 PF00017 PF00018
PDB:	1A0N 1AOT 1AOU 1AVZ 1AZG 1EFN 1FYN 1G83 1M27 1NYF 1NYG 1SHF 1ZBJ 2DQ7 2MQI 2MRJ 2MRK 3H0F 3H0H 3H0I 3UA6 3UA7 4D8D 4EIK 4U17 4U1P 4ZNX
PDBsum:	1A0N 1AOT 1AOU 1AVZ 1AZG 1EFN 1FYN 1G83 1M27 1NYF 1NYG 1SHF 1ZBJ 2DQ7 2MQI 2MRJ 2MRK 3H0F 3H0H 3H0I 3UA6 3UA7 4D8D 4EIK 4U17 4U1P 4ZNX
DIP:	33876
MINT:	93594
STRING:	ENSP00000346671;

Other Databases

GeneCards: FYN; Malacards: FYN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001664	G-protein coupled recepto r binding	IEA	molecular_function
GO:0001764	neuron migration	IEA	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IMP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IBA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	NAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005768	endosome	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005884	actin filament	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006468	protein phosphorylation	NAS	biological_process
GO:0006816	calcium ion transport	NAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007417	central nervous system de velopment	IBA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0007612	learning	TAS	biological_process
GO:0007631	feeding behavior	TAS	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014069	postsynaptic density	IEA	cellular_component
GO:0015631	tubulin binding	IEA	molecular_function
GO:0016032	viral process	IEA	biological_process
GO:0016477	cell migration	IBA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IMP	biological_process
GO:0030154	cell differentiation	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IEA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042110	T cell activation	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042177	negative regulation of pr otein catabolic process	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IEA	biological_process
GO:0042608	T cell receptor binding	IEA	molecular_function
GO:0042609	CD4 receptor binding	IEA	molecular_function
GO:0042610	CD8 receptor binding	IEA	molecular_function
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043548	phosphatidylinositol 3-ki nase binding	IEA	molecular_function
GO:0044325	ion channel binding	IEA	molecular_function
GO:0045087	innate immune response	IBA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048813	dendrite morphogenesis	IEA	biological_process
GO:0050690	regulation of defense res ponse to virus by virus	TAS	biological_process
GO:0050798	activated T cell prolifer ation	IEA	biological_process
GO:0050852	T cell receptor signaling pathway	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050966	detection of mechanical s timulus involved in senso ry perception of pain	IEA	biological_process
GO:0051428	peptide hormone receptor binding	IEA	molecular_function
GO:0070851	growth factor receptor bi nding	IPI	molecular_function
GO:0071375	cellular response to pept ide hormone stimulus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IEA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IEA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001664	G-protein coupled recepto r binding	IEA	molecular_function
GO:0001764	neuron migration	IEA	biological_process
GO:0001948	glycoprotein binding	IEA	molecular_function
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IMP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IEA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IBA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	NAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005884	actin filament	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006468	protein phosphorylation	NAS	biological_process
GO:0006816	calcium ion transport	NAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007417	central nervous system de velopment	IBA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0007612	learning	TAS	biological_process
GO:0007631	feeding behavior	TAS	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014069	postsynaptic density	IEA	cellular_component
GO:0015631	tubulin binding	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016477	cell migration	IBA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IMP	biological_process
GO:0030154	cell differentiation	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042110	T cell activation	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042177	negative regulation of pr otein catabolic process	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IEA	biological_process
GO:0042608	T cell receptor binding	IEA	molecular_function
GO:0042609	CD4 receptor binding	IEA	molecular_function
GO:0042610	CD8 receptor binding	IEA	molecular_function
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043548	phosphatidylinositol 3-ki nase binding	IEA	molecular_function
GO:0044325	ion channel binding	IEA	molecular_function
GO:0045087	innate immune response	IBA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0046777	protein autophosphorylati on	IEA	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0048813	dendrite morphogenesis	IEA	biological_process
GO:0050690	regulation of defense res ponse to virus by virus	TAS	biological_process
GO:0050798	activated T cell prolifer ation	IEA	biological_process
GO:0050852	T cell receptor signaling pathway	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050966	detection of mechanical s timulus involved in senso ry perception of pain	IEA	biological_process
GO:0051428	peptide hormone receptor binding	IEA	molecular_function
GO:0070851	growth factor receptor bi nding	IPI	molecular_function
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0071944	cell periphery	IEA	cellular_component
GO:1900182	positive regulation of pr otein localization to nuc leus	IEA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IEA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IMP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IBA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	NAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005768	endosome	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006468	protein phosphorylation	NAS	biological_process
GO:0006816	calcium ion transport	NAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IBA	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007417	central nervous system de velopment	IBA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0007612	learning	TAS	biological_process
GO:0007631	feeding behavior	TAS	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016477	cell migration	IBA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IMP	biological_process
GO:0030154	cell differentiation	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042110	T cell activation	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0050690	regulation of defense res ponse to virus by virus	TAS	biological_process
GO:0050852	T cell receptor signaling pathway	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0070851	growth factor receptor bi nding	IPI	molecular_function
GO:0045121	membrane raft	IDA	cellular_component

KEGG pathways

hsa04510  Focal adhesion
hsa05162  Measles
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04660  T cell receptor signaling pathway
hsa04520  Adherens junction
hsa04071  Sphingolipid signaling pathway
hsa04611  Platelet activation
hsa05416  Viral myocarditis
hsa04725  Cholinergic synapse
PTHR24418:SF44  Integrin signalling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05020  Prion diseases
PTHR24418:SF44  Cadherin signaling pathway
PTHR24418:SF44  Integrin signalling pathway
PTHR24418:SF44  Integrin signalling pathway
PTHR24418:SF296  Cadherin signaling pathway
PTHR24418:SF296  Axon guidance mediated by semaphorins
PTHR24418:SF44  Integrin signalling pathway
PTHR24418:SF44  Cadherin signaling pathway
PTHR24418:SF44  Axon guidance mediated by semaphorins
PTHR24418:SF44  Cadherin signaling pathway
PTHR24418:SF44  Cadherin signaling pathway
PTHR24418:SF44  Axon guidance mediated by semaphorins
PTHR24418:SF44  Axon guidance mediated by semaphorins
PTHR24418:SF44  Axon guidance mediated by semaphorins

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 15098360
Arterial hypertension	PMID: 17334644
Bipolar disorder	PMID: 19468241
Cleft lip	PMID: 18978678
Endometriosis	PMID: 19910323
Parkinson's disease	PMID: 18628988
Endometriosis	INFBASE19910323
Schizophrenia	PMID: 11121167

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19910323	Endometrio sis			62 (38 premenop ausal women wit h histologicall y diagnosed ova rian endometrio ma or peritonea l endometriosis , 24 women with out endometrios is)		SYN NSE	Show abstract