Endometriosis Knowledgebase

Search Result

Gene id

25945

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NECTIN3 Gene UCSC Ensembl

Aliases

CD113, CDW113, NECTIN-3, PPR3, PRR3, PVRL3, PVRR3

Gene name

nectin cell adhesion molecule 3

Alternate names

nectin-3, nectin 3, poliovirus receptor-related 3, poliovirus receptor-related protein 3,

Gene location

3q13.13 (111071758: 111201443) Exons: 13 NC_000003.12

Gene summary(Entrez)

This gene encodes a member of the nectin family of proteins, which function as adhesion molecules at adherens junctions. This family member interacts with other nectin-like proteins and with afadin, a filamentous actin-binding protein involved in the regulation of directional motility, cell proliferation and survival. This gene plays a role in ocular development involving the ciliary body. Mutations in this gene are believed to result in congenital ocular defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

OMIM

607147

Protein Summary

Protein general information

Q9NQS3

Name: Nectin 3 (CDw113) (Nectin cell adhesion molecule 3) (Poliovirus receptor related protein 3) (CD antigen CD113)

Length: 549 Mass: 61,002

Tissue specificity: Predominantly expressed in testis and placenta as well as in many cell lines, including epithelial cell lines. {ECO

Sequence

MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPIIVEPHVTAVWGKNVS
LKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKA
VTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSFPNETA
TIISQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPF
KSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISDPPTTTTLQPTIQWHPSTA
DIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVSVLAGIFCYRRRRTFRGDYFAKNYIPPSDMQ
KESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEH
YDENEDDLVSHVDGSVISRREWYV

Structural information

Protein Domains	Ig-like (59-165) Ig-like (170-258) Ig-like (269-354)
Interpro:	IPR013162 IPR007110 IPR013783 IPR003599 IPR013106 IPR033319
Prosite:	PS50835
Pfam:	PF08205 PF07686
PDB:	4FOM
PDBsum:	4FOM
DIP:	41491
MINT:	147327
STRING:	ENSP00000418070;

Other Databases

GeneCards: NECTIN3; Malacards: NECTIN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002089	lens morphogenesis in cam era-type eye	IEA	biological_process
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	ISS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0007286	spermatid development	IEA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0009566	fertilization	IEA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	ISS	molecular_function
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0043296	apical junction complex	IEA	cellular_component
GO:0045211	postsynaptic membrane	IEA	cellular_component
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0060042	retina morphogenesis in c amera-type eye	IEA	biological_process
GO:0002089	lens morphogenesis in cam era-type eye	IEA	biological_process
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005911	cell-cell junction	IEA	cellular_component
GO:0005911	cell-cell junction	IEA	cellular_component
GO:0005913	cell-cell adherens juncti on	IEA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IEA	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	ISS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0007286	spermatid development	IEA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0009566	fertilization	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042803	protein homodimerization activity	ISS	molecular_function
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0043296	apical junction complex	IEA	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0045211	postsynaptic membrane	IEA	cellular_component
GO:0045211	postsynaptic membrane	IEA	cellular_component
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IEA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0060042	retina morphogenesis in c amera-type eye	IEA	biological_process
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	ISS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	ISS	molecular_function
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function

KEGG pathways

hsa04514 Cell adhesion molecules
hsa04520 Adherens junction

Diseases

Associated diseases	References
Endometriosis	PMID: 22926846
Endometriosis	INFBASE22926846

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22926846	Endometrio sis			75 (55 women un dergoing endome trial biopsy or surgery for en dometriosis (20 proliferative endometrium fro m women with en dometriosis, pr oliferative end ometrium from w omen without en dometriosis, 20 peritoneal end ometriosis, 20 ovarian endomet riosis, 20 colo		Nectin-1 -3 -4 and Necl-2	Show abstract