Endometriosis Knowledgebase

Search Result

Gene id

2691

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

GHRH Gene UCSC Ensembl

Aliases

GHRF, GRF, INN

Gene name

growth hormone releasing hormone

Alternate names

somatoliberin, growth hormone releasing factor, sermorelin, somatocrinin, somatorelin,

Gene location

20q11.23 (37261816: 37251085) Exons: 5 NC_000020.11

Gene summary(Entrez)

This gene encodes a member of the glucagon family of proteins. The encoded preproprotein is produced in the hypothalamus and cleaved to generate the mature factor, known as somatoliberin, which acts to stimulate growth hormone release from the pituitary gland. Variant receptors for somatoliberin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]

OMIM

139190

Protein Summary

Protein general information

P01286

Name: Somatoliberin (Growth hormone releasing factor) (GRF) (Growth hormone releasing hormone) (GHRH) (Somatocrinin) (Somatorelin) (Sermorelin)

Length: 108 Mass: 12,447

Sequence

MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
GRQVDSMWAEQKQMELESILVALLQKHSRNSQG

Structural information

Interpro:	IPR000532
Prosite:	PS00260
Pfam:	PF00123
PDB:	5BQM
PDBsum:	5BQM
MINT:	8090632
STRING:	ENSP00000237527;

Other Databases

GeneCards: GHRH; Malacards: GHRH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	ISS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IC	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IDA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0016608	growth hormone-releasing hormone activity	IDA	molecular_function
GO:0016608	growth hormone-releasing hormone activity	IDA	molecular_function
GO:0019933	cAMP-mediated signaling	IDA	biological_process
GO:0021984	adenohypophysis developme nt	ISS	biological_process
GO:0030252	growth hormone secretion	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031770	growth hormone-releasing hormone receptor binding	IPI	molecular_function
GO:0031770	growth hormone-releasing hormone receptor binding	IPI	molecular_function
GO:0032094	response to food	ISS	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IMP	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IMP	biological_process
GO:0043195	terminal bouton	ISS	cellular_component
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	NAS	biological_process
GO:0046005	positive regulation of ci rcadian sleep/wake cycle, REM sleep	NAS	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	NAS	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IMP	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0046005	positive regulation of ci rcadian sleep/wake cycle, REM sleep	IMP	biological_process
GO:0005179	hormone activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IEA	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	ISS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IC	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IDA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0016608	growth hormone-releasing hormone activity	IDA	molecular_function
GO:0016608	growth hormone-releasing hormone activity	IDA	molecular_function
GO:0019933	cAMP-mediated signaling	IDA	biological_process
GO:0021984	adenohypophysis developme nt	IEA	biological_process
GO:0021984	adenohypophysis developme nt	ISS	biological_process
GO:0030252	growth hormone secretion	IEA	biological_process
GO:0030252	growth hormone secretion	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031770	growth hormone-releasing hormone receptor binding	IEA	molecular_function
GO:0031770	growth hormone-releasing hormone receptor binding	IPI	molecular_function
GO:0031770	growth hormone-releasing hormone receptor binding	IPI	molecular_function
GO:0032094	response to food	IEA	biological_process
GO:0032094	response to food	ISS	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IEA	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IMP	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IMP	biological_process
GO:0043195	terminal bouton	IEA	cellular_component
GO:0043195	terminal bouton	ISS	cellular_component
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	NAS	biological_process
GO:0046005	positive regulation of ci rcadian sleep/wake cycle, REM sleep	NAS	biological_process
GO:0046887	positive regulation of ho rmone secretion	IEA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	NAS	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IMP	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0046005	positive regulation of ci rcadian sleep/wake cycle, REM sleep	IMP	biological_process
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	ISS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IC	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IDA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0016608	growth hormone-releasing hormone activity	IDA	molecular_function
GO:0016608	growth hormone-releasing hormone activity	IDA	molecular_function
GO:0019933	cAMP-mediated signaling	IDA	biological_process
GO:0021984	adenohypophysis developme nt	ISS	biological_process
GO:0030252	growth hormone secretion	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031770	growth hormone-releasing hormone receptor binding	IPI	molecular_function
GO:0031770	growth hormone-releasing hormone receptor binding	IPI	molecular_function
GO:0032094	response to food	ISS	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IMP	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IMP	biological_process
GO:0043195	terminal bouton	ISS	cellular_component
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	NAS	biological_process
GO:0046005	positive regulation of ci rcadian sleep/wake cycle, REM sleep	NAS	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	NAS	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IMP	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0060124	positive regulation of gr owth hormone secretion	IDA	biological_process
GO:0046005	positive regulation of ci rcadian sleep/wake cycle, REM sleep	IMP	biological_process

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Cancer	PMID: 16606630
Endometrial cancer	PMID: 10022420
Endometriosis	PMID: 18684444
Gigantism	OMIM: 139190
Hypopituitarism	KEGG: H01700
Osteoporosis	PMID: 19487270
Pituitary dwarfism	KEGG: H00254
Endometriosis	INFBASE18684444
Psychiatric disorders	PMID: 19086053

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18684444	Endometrio sis					GHRH SV1	Show abstract