Endometriosis Knowledgebase

Search Result

Gene id

27086

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FOXP1 Gene UCSC Ensembl

Aliases

12CC4, HSPC215, MFH, QRF1, hFKH1B

Gene name

forkhead box P1

Alternate names

forkhead box protein P1, fork head-related protein like B, glutamine-rich factor 1, mac-1-regulated forkhead,

Gene location

3p13 (71583988: 70954713) Exons: 32 NC_000003.12

Gene summary(Entrez)

This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

OMIM

605515

Protein Summary

Protein general information

Q9H334

Name: Forkhead box protein P1 (Mac 1 regulated forkhead) (MFH)

Length: 677 Mass: 75,317

Tissue specificity: Isoform 8 is specifically expressed in embryonic stem cells. {ECO

Sequence

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQ
QQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFYKKQ
QEQLQLQLLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIP
TELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSH
PLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKERLQAMMTHLHVKSTE
PKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSA
DIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVR
VENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLAS
AIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNED
ME

Structural information

Interpro:	IPR001766 IPR032354 IPR030456 IPR011991
Prosite:	PS00658 PS50039 PS00028
Pfam:	PF00250 PF16159
PDB:	2KIU
PDBsum:	2KIU
DIP:	36585
STRING:	ENSP00000318902;

Other Databases

GeneCards: FOXP1; Malacards: FOXP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IBA	molecular_function
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0030316	osteoclast differentiatio n	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IDA	biological_process
GO:0035926	chemokine (C-C motif) lig and 2 secretion	IDA	biological_process
GO:0036035	osteoclast development	IDA	biological_process
GO:0042116	macrophage activation	IDA	biological_process
GO:0042117	monocyte activation	IDA	biological_process
GO:0042118	endothelial cell activati on	IMP	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043621	protein self-association	IMP	molecular_function
GO:0045655	regulation of monocyte di fferentiation	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IMP	biological_process
GO:0050681	androgen receptor binding	IDA	molecular_function
GO:0050706	regulation of interleukin -1 beta secretion	IDA	biological_process
GO:0050727	regulation of inflammator y response	IDA	biological_process
GO:0060766	negative regulation of an drogen receptor signaling pathway	IDA	biological_process
GO:0061470	T follicular helper cell differentiation	ISS	biological_process
GO:0072619	interleukin-21 secretion	ISS	biological_process
GO:1900424	regulation of defense res ponse to bacterium	IDA	biological_process
GO:1901256	regulation of macrophage colony-stimulating factor production	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IMP	biological_process
GO:2001182	regulation of interleukin -12 secretion	IDA	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IBA	molecular_function
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0030316	osteoclast differentiatio n	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IDA	biological_process
GO:0035926	chemokine (C-C motif) lig and 2 secretion	IDA	biological_process
GO:0036035	osteoclast development	IDA	biological_process
GO:0042116	macrophage activation	IDA	biological_process
GO:0042117	monocyte activation	IDA	biological_process
GO:0042118	endothelial cell activati on	IMP	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043621	protein self-association	IMP	molecular_function
GO:0045655	regulation of monocyte di fferentiation	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IMP	biological_process
GO:0050681	androgen receptor binding	IDA	molecular_function
GO:0050706	regulation of interleukin -1 beta secretion	IDA	biological_process
GO:0050727	regulation of inflammator y response	IDA	biological_process
GO:0060766	negative regulation of an drogen receptor signaling pathway	IDA	biological_process
GO:0061470	T follicular helper cell differentiation	ISS	biological_process
GO:0072619	interleukin-21 secretion	ISS	biological_process
GO:1900424	regulation of defense res ponse to bacterium	IDA	biological_process
GO:1901256	regulation of macrophage colony-stimulating factor production	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IMP	biological_process
GO:2001182	regulation of interleukin -12 secretion	IDA	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IBA	molecular_function
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0030316	osteoclast differentiatio n	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IDA	biological_process
GO:0035926	chemokine (C-C motif) lig and 2 secretion	IDA	biological_process
GO:0036035	osteoclast development	IDA	biological_process
GO:0042116	macrophage activation	IDA	biological_process
GO:0042117	monocyte activation	IDA	biological_process
GO:0042118	endothelial cell activati on	IMP	biological_process
GO:0043621	protein self-association	IMP	molecular_function
GO:0045655	regulation of monocyte di fferentiation	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IMP	biological_process
GO:0050681	androgen receptor binding	IDA	molecular_function
GO:0050706	regulation of interleukin -1 beta secretion	IDA	biological_process
GO:0050727	regulation of inflammator y response	IDA	biological_process
GO:0060766	negative regulation of an drogen receptor signaling pathway	IDA	biological_process
GO:0061470	T follicular helper cell differentiation	ISS	biological_process
GO:0072619	interleukin-21 secretion	ISS	biological_process
GO:1900424	regulation of defense res ponse to bacterium	IDA	biological_process
GO:1901256	regulation of macrophage colony-stimulating factor production	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IMP	biological_process
GO:2001182	regulation of interleukin -12 secretion	IDA	biological_process

KEGG pathways

hsa05206 MicroRNAs in cancer

Diseases

Associated diseases	References
Attention-deficit hyperactivity disorder (ADHD)	PMID: 18821565
Behcet's disease	PMID: 20622878
Endometriosis	PMID: 18332236
Mental retardation	OMIM: 605515

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18332236	Endometrio sis					FOXP1	Show abstract