Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 27178
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol IL37   Gene   UCSC   Ensembl
Aliases FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H, IL-1H4, IL-1RP1, IL-37, IL1F7, IL1H4, IL1RP1
Gene name interleukin 37
Alternate names interleukin-37, FIL1 zeta, IL-1 zeta, IL-1F7b (IL-1H4, IL-1H, IL-1RP1), IL-1X protein, IL1F7 (canonical product IL-1F7b), interleukin 1 family member 7, interleukin 1, zeta, interleukin-1 homolog 4, interleukin-1 superfamily z, interleukin-1-related protein, interleukin-23,
Gene location 2q14.1 (112908884: 112918881)     Exons: 7     NC_000002.12
Gene summary(Entrez) The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
OMIM 605510

Protein Summary

Protein general information Q9NZH6  

Name: Interleukin-37 (FIL1 zeta) (IL-1X) (Interleukin-1 family member 7) (IL-1F7) (Interleukin-1 homolog 4) (IL-1H) (IL-1H4) (Interleukin-1 zeta) (IL-1 zeta) (Interleukin-1-related protein) (IL-1RP1) (Interleukin-23) (IL-37)

Length: 218  Mass: 24,126

Tissue specificity: In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are

Sequence MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSG
NLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESA
RRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Structural information
Interpro:  IPR000975 IPR003297 IPR008996

Pfam:  
PF00340

PDB:  
5HN1
PDBsum:   5HN1
STRING:   ENSP00000263326;
Other Databases GeneCards:  IL37;  Malacards:  IL37

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005125 cytokine activity
IBA molecular_function
GO:0005149 interleukin-1 receptor bi
nding
TAS molecular_function
GO:0005149 interleukin-1 receptor bi
nding
NAS molecular_function
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005730 nucleolus
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
NAS biological_process
GO:0006955 immune response
NAS biological_process
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological_process
GO:0005125 cytokine activity
IBA molecular_function
GO:0005125 cytokine activity
IEA molecular_function
GO:0005149 interleukin-1 receptor bi
nding
IEA molecular_function
GO:0005149 interleukin-1 receptor bi
nding
TAS molecular_function
GO:0005149 interleukin-1 receptor bi
nding
NAS molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005730 nucleolus
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
IEA biological_process
GO:0006955 immune response
NAS biological_process
GO:0006955 immune response
NAS biological_process
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological_process
GO:0005125 cytokine activity
IBA molecular_function
GO:0005149 interleukin-1 receptor bi
nding
TAS molecular_function
GO:0005149 interleukin-1 receptor bi
nding
NAS molecular_function
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005730 nucleolus
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0006955 immune response
NAS biological_process
GO:0006955 immune response
NAS biological_process
GO:0019221 cytokine-mediated signali
ng pathway
IBA biological_process

Diseases

Associated diseases References
Endometriosis INFBASE26342048

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28322860 Endometrio
sis


Female infertility
Show abstract
26342048 Endometrio
sis


Female infertility
Show abstract