Endometriosis Knowledgebase

Search Result

Gene id

283

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ANG Gene UCSC Ensembl

Aliases

ALS9, HEL168, RAA1, RNASE4, RNASE5

Gene name

angiogenin

Alternate names

angiogenin, RNase 5, angiogenin, ribonuclease, RNase A family, 5, epididymis luminal protein 168, ribonuclease 5, ribonuclease A A1, ribonuclease A family member 5,

Gene location

14q11.2 (20684176: 20694185) Exons: 3 NC_000014.9

Gene summary(Entrez)

The protein encoded by this gene is an exceedingly potent mediator of new blood vessel formation. It hydrolyzes cellular tRNAs resulting in decreased protein synthesis and is similar to pancreatic ribonuclease. In addition, the mature peptide has antimicrobial activity against some bacteria and fungi, including S. pneumoniae and C. albicans. Alternative splicing results in two transcript variants encoding the same protein. This gene and the gene that encodes ribonuclease, RNase A family, 4 share promoters and 5' exons. Each gene splices to a unique downstream exon that contains its complete coding region. [provided by RefSeq, Aug 2014]

OMIM

105850

Protein Summary

Protein general information

P03950

Name: Angiogenin (EC 3.1.27. ) (Ribonuclease 5) (RNase 5)

Length: 147 Mass: 16,550

Tissue specificity: Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons. {ECO

Sequence

MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKR
SIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP

Structural information

Motifs	Nucleolar localization(55-59)
Interpro:	IPR001427 IPR023411 IPR023412
Prosite:	PS00127
Pfam:	PF00074
PDB:	1A4Y 1ANG 1AWZ 1B1E 1B1I 1B1J 1GV7 1H0D 1H52 1H53 1HBY 1K58 1K59 1K5A 1K5B 1UN3 1UN4 1UN5 2ANG 4AHD 4AHE 4AHF 4AHG 4AHH 4AHI 4AHJ 4AHK 4AHL 4AHM 4AHN 4AOH 4B36 5EOP 5EPZ 5EQO 5M9A 5M9C 5M9G 5M9J 5M9M 5M9P 5M9Q 5M9R 5M9S 5M9T 5M9V
PDBsum:	1A4Y 1ANG 1AWZ 1B1E 1B1I 1B1J 1GV7 1H0D 1H52 1H53 1HBY 1K58 1K59 1K5A 1K5B 1UN3 1UN4 1UN5 2ANG 4AHD 4AHE 4AHF 4AHG 4AHH 4AHI 4AHJ 4AHK 4AHL 4AHM 4AHN 4AOH 4B36 5EOP 5EPZ 5EQO 5M9A 5M9C 5M9G 5M9J 5M9M 5M9P 5M9Q 5M9R 5M9S 5M9T 5M9V
STRING:	ENSP00000336762;

Other Databases

GeneCards: ANG; Malacards: ANG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	TAS	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001541	ovarian follicle developm ent	NAS	biological_process
GO:0001556	oocyte maturation	NAS	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	NAS	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001878	response to yeast	IDA	biological_process
GO:0001890	placenta development	NAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0003677	DNA binding	IC	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0004519	endonuclease activity	TAS	molecular_function
GO:0004540	ribonuclease activity	IDA	molecular_function
GO:0004540	ribonuclease activity	IDA	molecular_function
GO:0005102	receptor binding	IDA	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005605	basal lamina	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005730	nucleolus	ISS	cellular_component
GO:0006651	diacylglycerol biosynthet ic process	IDA	biological_process
GO:0007154	cell communication	NAS	biological_process
GO:0007202	activation of phospholipa se C activity	IMP	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0009303	rRNA transcription	IMP	biological_process
GO:0009725	response to hormone	IDA	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0017148	negative regulation of tr anslation	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0019843	rRNA binding	TAS	molecular_function
GO:0030041	actin filament polymeriza tion	ISS	biological_process
GO:0030426	growth cone	ISS	cellular_component
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0032311	angiogenin-PRI complex	IDA	cellular_component
GO:0032311	angiogenin-PRI complex	IPI	cellular_component
GO:0032431	activation of phospholipa se A2 activity	IMP	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042277	peptide binding	IDA	molecular_function
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042592	homeostatic process	NAS	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043025	neuronal cell body	ISS	cellular_component
GO:0045087	innate immune response	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	ISS	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090501	RNA phosphodiester bond h ydrolysis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001541	ovarian follicle developm ent	NAS	biological_process
GO:0001556	oocyte maturation	NAS	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	NAS	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001878	response to yeast	IEA	biological_process
GO:0001878	response to yeast	IDA	biological_process
GO:0001890	placenta development	NAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IC	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0004518	nuclease activity	IEA	molecular_function
GO:0004519	endonuclease activity	IEA	molecular_function
GO:0004519	endonuclease activity	TAS	molecular_function
GO:0004540	ribonuclease activity	IEA	molecular_function
GO:0004540	ribonuclease activity	IDA	molecular_function
GO:0004540	ribonuclease activity	IDA	molecular_function
GO:0005102	receptor binding	IDA	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005605	basal lamina	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005730	nucleolus	ISS	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0006651	diacylglycerol biosynthet ic process	IDA	biological_process
GO:0007154	cell communication	NAS	biological_process
GO:0007202	activation of phospholipa se C activity	IMP	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0009303	rRNA transcription	IMP	biological_process
GO:0009725	response to hormone	IDA	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0017148	negative regulation of tr anslation	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IEA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0019843	rRNA binding	TAS	molecular_function
GO:0030041	actin filament polymeriza tion	ISS	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030426	growth cone	IEA	cellular_component
GO:0030426	growth cone	ISS	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0032311	angiogenin-PRI complex	IDA	cellular_component
GO:0032311	angiogenin-PRI complex	IPI	cellular_component
GO:0032431	activation of phospholipa se A2 activity	IMP	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042277	peptide binding	IDA	molecular_function
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042592	homeostatic process	NAS	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043025	neuronal cell body	ISS	cellular_component
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	ISS	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IEA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090305	nucleic acid phosphodiest er bond hydrolysis	IEA	biological_process
GO:0090501	RNA phosphodiester bond h ydrolysis	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	IDA	biological_process
GO:0001541	ovarian follicle developm ent	NAS	biological_process
GO:0001556	oocyte maturation	NAS	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	NAS	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001878	response to yeast	IDA	biological_process
GO:0001890	placenta development	NAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0003677	DNA binding	IC	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0004519	endonuclease activity	TAS	molecular_function
GO:0004540	ribonuclease activity	IDA	molecular_function
GO:0004540	ribonuclease activity	IDA	molecular_function
GO:0005102	receptor binding	IDA	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005605	basal lamina	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005730	nucleolus	ISS	cellular_component
GO:0006651	diacylglycerol biosynthet ic process	IDA	biological_process
GO:0007154	cell communication	NAS	biological_process
GO:0007202	activation of phospholipa se C activity	IMP	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0009303	rRNA transcription	IMP	biological_process
GO:0009725	response to hormone	IDA	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0019843	rRNA binding	TAS	molecular_function
GO:0030041	actin filament polymeriza tion	ISS	biological_process
GO:0030426	growth cone	ISS	cellular_component
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0032311	angiogenin-PRI complex	IDA	cellular_component
GO:0032311	angiogenin-PRI complex	IPI	cellular_component
GO:0032431	activation of phospholipa se A2 activity	IMP	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042277	peptide binding	IDA	molecular_function
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042592	homeostatic process	NAS	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043025	neuronal cell body	ISS	cellular_component
GO:0045087	innate immune response	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	ISS	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Amyotrophic lateral sclerosis (ALS)	PMID: 17113198
Endometriosis	PMID: 25920308
Hypertension	PMID: 19253715
Hypertrophy	PMID: 19253715
Implantation failure	PMID: 18955785
Oocyte maturity and fertilization	PMID: 11438326
Implantation defects	INFBASE18955785
Endometriosis	INFBASE18955785

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
15236995	Endometrio sis	64 (38 women wi th endometriosi s, 26 women wit h cystadenomas)	Angiogenin	Show abstract
14748845	Endometrio sis	148 (77 cases, 71 controls)	TNFR-1 angiogenin	Show abstract
18955785	Endometrio sis	61 (32 women wi th endometriosi s and 29 contro l women)		Show abstract