Endometriosis Knowledgebase

Search Result

Gene id

2833

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCR3 Gene UCSC Ensembl

Aliases

CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR

Gene name

C-X-C motif chemokine receptor 3

Alternate names

C-X-C chemokine receptor type 3, G protein-coupled receptor 9, IP-10 receptor, Mig receptor, chemokine (C-X-C motif) receptor 3, chemokine receptor 3, interferon-inducible protein 10 receptor,

Gene location

Xq13.1 (71618516: 71615912) Exons: 4 NC_000023.11

Gene summary(Entrez)

This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716). [provided by RefSeq, Jun 2011]

OMIM

300574

Protein Summary

Protein general information

P49682

Name: C X C chemokine receptor type 3 (CXC R3) (CXCR 3) (CKR L2) (G protein coupled receptor 9) (Interferon inducible protein 10 receptor) (IP 10 receptor) (CD antigen CD183)

Length: 368 Mass: 40,660

Tissue specificity: Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level). {ECO

Sequence

MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLGNGAVA
AVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRY
LNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFL
LPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL

Structural information

Interpro:	IPR004070 IPR000355 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
DIP:	5891
MINT:	91399
STRING:	ENSP00000362795;

Other Databases

GeneCards: CXCR3; Malacards: CXCR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0002685	regulation of leukocyte m igration	IEA	biological_process
GO:0004872	receptor activity	IDA	molecular_function
GO:0004872	receptor activity	IDA	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010818	T cell chemotaxis	IEA	biological_process
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0019722	calcium-mediated signalin g	IEA	biological_process
GO:0019956	chemokine binding	IPI	molecular_function
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0030816	positive regulation of cA MP metabolic process	IDA	biological_process
GO:0043950	positive regulation of cA MP-mediated signaling	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0050921	positive regulation of ch emotaxis	IDA	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IMP	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0071954	chemokine (C-C motif) lig and 11 production	IDA	biological_process
GO:0071954	chemokine (C-C motif) lig and 11 production	IDA	biological_process
GO:1900118	negative regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:1900119	positive regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0002685	regulation of leukocyte m igration	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004872	receptor activity	IDA	molecular_function
GO:0004872	receptor activity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004950	chemokine receptor activi ty	IEA	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0010818	T cell chemotaxis	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0019722	calcium-mediated signalin g	IEA	biological_process
GO:0019956	chemokine binding	IPI	molecular_function
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0030816	positive regulation of cA MP metabolic process	IDA	biological_process
GO:0043950	positive regulation of cA MP-mediated signaling	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0050921	positive regulation of ch emotaxis	IDA	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IMP	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0071954	chemokine (C-C motif) lig and 11 production	IDA	biological_process
GO:0071954	chemokine (C-C motif) lig and 11 production	IDA	biological_process
GO:1900118	negative regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:1900119	positive regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0004872	receptor activity	IDA	molecular_function
GO:0004872	receptor activity	IDA	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0019956	chemokine binding	IPI	molecular_function
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0030816	positive regulation of cA MP metabolic process	IDA	biological_process
GO:0043950	positive regulation of cA MP-mediated signaling	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0050921	positive regulation of ch emotaxis	IDA	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IMP	biological_process
GO:0071954	chemokine (C-C motif) lig and 11 production	IDA	biological_process
GO:0071954	chemokine (C-C motif) lig and 11 production	IDA	biological_process
GO:1900118	negative regulation of ex ecution phase of apoptosi s	IDA	biological_process
GO:1900119	positive regulation of ex ecution phase of apoptosi s	IDA	biological_process

KEGG pathways

hsa04060 Cytokine-cytokine receptor interaction
hsa04062 Chemokine signaling pathway

Diseases

Associated diseases	References
Asthma	PMID: 16043121
Endometriosis	PMID: 17707463
Rheumatoid arthritis	PMID: 11196695
Ovarian cancer	INFBASE17707463
Endometriosis	INFBASE17707463
Systemic lupus erythematosus	PMID: 11196695

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17707463	Endometrio sis			26 (12 ovarian carcinomas, 8 e ndometriosis, 6 normal ovaries )		IL-8 ENA-78 GRO-alpha I-TAC Mig SDF-1 CXCR2 CXCR3 and CXCR4	Show abstract