Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 2833
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CXCR3   Gene   UCSC   Ensembl
Aliases CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR
Gene name C-X-C motif chemokine receptor 3
Alternate names C-X-C chemokine receptor type 3, G protein-coupled receptor 9, IP-10 receptor, Mig receptor, chemokine (C-X-C motif) receptor 3, chemokine receptor 3, interferon-inducible protein 10 receptor,
Gene location Xq13.1 (71618516: 71615912)     Exons: 4     NC_000023.11
Gene summary(Entrez) This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716). [provided by RefSeq, Jun 2011]
OMIM 300574

Protein Summary

Protein general information P49682  

Name: C X C chemokine receptor type 3 (CXC R3) (CXCR 3) (CKR L2) (G protein coupled receptor 9) (Interferon inducible protein 10 receptor) (IP 10 receptor) (CD antigen CD183)

Length: 368  Mass: 40,660

Tissue specificity: Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level). {ECO

Sequence MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLGNGAVA
AVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRY
LNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFL
LPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL
Structural information
Interpro:  IPR004070 IPR000355 IPR000276 IPR017452
Prosite:   PS00237 PS50262

Pfam:  
PF00001

DIP:  
5891
MINT:   91399
STRING:   ENSP00000362795;
Other Databases GeneCards:  CXCR3;  Malacards:  CXCR3

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001525 angiogenesis
IEA biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0002685 regulation of leukocyte m
igration
IEA biological_process
GO:0004872 receptor activity
IDA molecular_function
GO:0004872 receptor activity
IDA molecular_function
GO:0004950 chemokine receptor activi
ty
TAS molecular_function
GO:0005737 cytoplasm
TAS cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0006915 apoptotic process
IEA biological_process
GO:0006928 movement of cell or subce
llular component
TAS biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0007155 cell adhesion
TAS biological_process
GO:0007166 cell surface receptor sig
naling pathway
IDA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IMP biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0009897 external side of plasma m
embrane
IEA cellular_component
GO:0010818 T cell chemotaxis
IEA biological_process
GO:0016494 C-X-C chemokine receptor
activity
IEA molecular_function
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0019722 calcium-mediated signalin
g
IEA biological_process
GO:0019956 chemokine binding
IPI molecular_function
GO:0019958 C-X-C chemokine binding
IDA molecular_function
GO:0019958 C-X-C chemokine binding
IDA molecular_function
GO:0030816 positive regulation of cA
MP metabolic process
IDA biological_process
GO:0043950 positive regulation of cA
MP-mediated signaling
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0050921 positive regulation of ch
emotaxis
IDA biological_process
GO:0051281 positive regulation of re
lease of sequestered calc
ium ion into cytosol
IMP biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IEA biological_process
GO:0071954 chemokine (C-C motif) lig
and 11 production
IDA biological_process
GO:0071954 chemokine (C-C motif) lig
and 11 production
IDA biological_process
GO:1900118 negative regulation of ex
ecution phase of apoptosi
s
IDA biological_process
GO:1900119 positive regulation of ex
ecution phase of apoptosi
s
IDA biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0002685 regulation of leukocyte m
igration
IEA biological_process
GO:0004871 signal transducer activit
y
IEA molecular_function
GO:0004872 receptor activity
IDA molecular_function
GO:0004872 receptor activity
IDA molecular_function
GO:0004930 G-protein coupled recepto
r activity
IEA molecular_function
GO:0004930 G-protein coupled recepto
r activity
IEA molecular_function
GO:0004950 chemokine receptor activi
ty
IEA molecular_function
GO:0004950 chemokine receptor activi
ty
TAS molecular_function
GO:0005622 intracellular
IEA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0006915 apoptotic process
IEA biological_process
GO:0006928 movement of cell or subce
llular component
TAS biological_process
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0007155 cell adhesion
TAS biological_process
GO:0007165 signal transduction
IEA biological_process
GO:0007166 cell surface receptor sig
naling pathway
IDA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IMP biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IEA biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0009897 external side of plasma m
embrane
IEA cellular_component
GO:0009986 cell surface
IEA cellular_component
GO:0010818 T cell chemotaxis
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016494 C-X-C chemokine receptor
activity
IEA molecular_function
GO:0016494 C-X-C chemokine receptor
activity
IEA molecular_function
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0019722 calcium-mediated signalin
g
IEA biological_process
GO:0019956 chemokine binding
IPI molecular_function
GO:0019958 C-X-C chemokine binding
IDA molecular_function
GO:0019958 C-X-C chemokine binding
IDA molecular_function
GO:0030816 positive regulation of cA
MP metabolic process
IDA biological_process
GO:0043950 positive regulation of cA
MP-mediated signaling
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0050921 positive regulation of ch
emotaxis
IDA biological_process
GO:0051281 positive regulation of re
lease of sequestered calc
ium ion into cytosol
IMP biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IEA biological_process
GO:0071954 chemokine (C-C motif) lig
and 11 production
IDA biological_process
GO:0071954 chemokine (C-C motif) lig
and 11 production
IDA biological_process
GO:1900118 negative regulation of ex
ecution phase of apoptosi
s
IDA biological_process
GO:1900119 positive regulation of ex
ecution phase of apoptosi
s
IDA biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0004872 receptor activity
IDA molecular_function
GO:0004872 receptor activity
IDA molecular_function
GO:0004950 chemokine receptor activi
ty
TAS molecular_function
GO:0005737 cytoplasm
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0006928 movement of cell or subce
llular component
TAS biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0007155 cell adhesion
TAS biological_process
GO:0007166 cell surface receptor sig
naling pathway
IDA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IMP biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0019956 chemokine binding
IPI molecular_function
GO:0019958 C-X-C chemokine binding
IDA molecular_function
GO:0019958 C-X-C chemokine binding
IDA molecular_function
GO:0030816 positive regulation of cA
MP metabolic process
IDA biological_process
GO:0043950 positive regulation of cA
MP-mediated signaling
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0050921 positive regulation of ch
emotaxis
IDA biological_process
GO:0051281 positive regulation of re
lease of sequestered calc
ium ion into cytosol
IMP biological_process
GO:0071954 chemokine (C-C motif) lig
and 11 production
IDA biological_process
GO:0071954 chemokine (C-C motif) lig
and 11 production
IDA biological_process
GO:1900118 negative regulation of ex
ecution phase of apoptosi
s
IDA biological_process
GO:1900119 positive regulation of ex
ecution phase of apoptosi
s
IDA biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway

Diseases

Associated diseases References
Asthma PMID: 16043121
Endometriosis PMID: 17707463
Rheumatoid arthritis PMID: 11196695
Ovarian cancer INFBASE17707463
Endometriosis INFBASE17707463
Systemic lupus erythematosus PMID: 11196695

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17707463 Endometrio
sis

26 (12 ovarian
carcinomas, 8 e
ndometriosis, 6
normal ovaries
)
IL-8
ENA-78
GRO-alpha
I-TAC
Mig
SDF-1
CXCR2
CXCR3
and CXCR4
Show abstract