Endometriosis Knowledgebase

Search Result

Gene id

284

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ANGPT1 Gene UCSC Ensembl

Aliases

AGP1, AGPT, ANG1

Gene name

angiopoietin 1

Alternate names

angiopoietin-1, ANG-1,

Gene location

8q23.1 (107498054: 107249481) Exons: 10 NC_000008.11

Gene summary(Entrez)

This gene encodes a secreted glycoprotein that belongs to the angiopoietin family. Members of this family play important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The protein encoded by this gene is a secreted glycoprotein that activates the receptor by inducing its tyrosine phosphorylation. It plays a critical role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme and inhibits endothelial permeability. The protein also contributes to blood vessel maturation and stability, and may be involved in early development of the heart. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2015]

OMIM

601667

Protein Summary

Protein general information

Q15389

Name: Angiopoietin 1 (ANG 1)

Length: 498 Mass: 57,513

Sequence

MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRDAPHVE
PDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVET
QVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTR
QTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRI
ELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFD
ACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Structural information

Protein Domains	Fibrinogen (277-497)
Interpro:	IPR028843 IPR014716 IPR014715 IPR002181 IPR020837
Prosite:	PS00514 PS51406
Pfam:	PF00147
CDD:	cd00087
PDB:	4EPU 4JYO 4K0V
PDBsum:	4EPU 4JYO 4K0V
STRING:	ENSP00000428340;

Other Databases

GeneCards: ANGPT1; Malacards: ANGPT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological_process
GO:0002040	sprouting angiogenesis	IDA	biological_process
GO:0002040	sprouting angiogenesis	IDA	biological_process
GO:0002092	positive regulation of re ceptor internalization	IDA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IEA	biological_process
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0007162	negative regulation of ce ll adhesion	IDA	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014842	regulation of skeletal mu scle satellite cell proli feration	IDA	biological_process
GO:0030097	hemopoiesis	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030210	heparin biosynthetic proc ess	IDA	biological_process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological_process
GO:0031589	cell-substrate adhesion	IEA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0034394	protein localization to c ell surface	IDA	biological_process
GO:0042308	negative regulation of pr otein import into nucleus	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043116	negative regulation of va scular permeability	IDA	biological_process
GO:0043116	negative regulation of va scular permeability	IDA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IEA	biological_process
GO:0043393	regulation of protein bin ding	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045785	positive regulation of ce ll adhesion	IEA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050918	positive chemotaxis	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0072012	glomerulus vasculature de velopment	ISS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2000446	regulation of macrophage migration inhibitory fact or signaling pathway	IEA	biological_process
GO:0001936	regulation of endothelial cell proliferation	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological_process
GO:0002040	sprouting angiogenesis	IDA	biological_process
GO:0002040	sprouting angiogenesis	IDA	biological_process
GO:0002092	positive regulation of re ceptor internalization	IDA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IEA	biological_process
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0007162	negative regulation of ce ll adhesion	IDA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IDA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014842	regulation of skeletal mu scle satellite cell proli feration	IDA	biological_process
GO:0030097	hemopoiesis	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030210	heparin biosynthetic proc ess	IDA	biological_process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular_function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological_process
GO:0031589	cell-substrate adhesion	IEA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0034394	protein localization to c ell surface	IDA	biological_process
GO:0042308	negative regulation of pr otein import into nucleus	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043116	negative regulation of va scular permeability	IEA	biological_process
GO:0043116	negative regulation of va scular permeability	IDA	biological_process
GO:0043116	negative regulation of va scular permeability	IDA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IEA	biological_process
GO:0043393	regulation of protein bin ding	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045785	positive regulation of ce ll adhesion	IEA	biological_process
GO:0048014	Tie signaling pathway	IEA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050918	positive chemotaxis	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0072012	glomerulus vasculature de velopment	IEA	biological_process
GO:0072012	glomerulus vasculature de velopment	ISS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2000446	regulation of macrophage migration inhibitory fact or signaling pathway	IEA	biological_process
GO:0001936	regulation of endothelial cell proliferation	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0002040	sprouting angiogenesis	IDA	biological_process
GO:0002040	sprouting angiogenesis	IDA	biological_process
GO:0002092	positive regulation of re ceptor internalization	IDA	biological_process
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0007162	negative regulation of ce ll adhesion	IDA	biological_process
GO:0007171	activation of transmembra ne receptor protein tyros ine kinase activity	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0014842	regulation of skeletal mu scle satellite cell proli feration	IDA	biological_process
GO:0030210	heparin biosynthetic proc ess	IDA	biological_process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological_process
GO:0034394	protein localization to c ell surface	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043116	negative regulation of va scular permeability	IDA	biological_process
GO:0043116	negative regulation of va scular permeability	IDA	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050918	positive chemotaxis	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0072012	glomerulus vasculature de velopment	ISS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:0001936	regulation of endothelial cell proliferation	IDA	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05323  Rheumatoid arthritis

Diseases

Associated diseases	References
Endometriosis	PMID: 16723371
Female infertility	PMID: 18644593
Ovarian hyperstimulation syndrome (OHSS)	PMID: 25485810
Polycystic ovary syndrome (PCOS)	PMID: 24889290
Endometriosis	INFBASE15019822

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
16723371	Endometrio sis	120 (56 women w ith severe endo metriosis, 64 w omen without en dometriosis)	Ang-1 Ang-2 Tie-2	Show abstract
18644593	Endometrio sis	60 (30 women wi th endometriosi s, 30 endometri um biopsy sampl es from 30 heal thy women)	ANGPT1 ANGPT2 MMP-1 MMP-2 MMP-9 VEGF	Show abstract
15019822	Endometrio sis		ANGPT1 ANGPT2	Show abstract