Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 284
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol ANGPT1   Gene   UCSC   Ensembl
Aliases AGP1, AGPT, ANG1
Gene name angiopoietin 1
Alternate names angiopoietin-1, ANG-1,
Gene location 8q23.1 (107498054: 107249481)     Exons: 10     NC_000008.11
Gene summary(Entrez) This gene encodes a secreted glycoprotein that belongs to the angiopoietin family. Members of this family play important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The protein encoded by this gene is a secreted glycoprotein that activates the receptor by inducing its tyrosine phosphorylation. It plays a critical role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme and inhibits endothelial permeability. The protein also contributes to blood vessel maturation and stability, and may be involved in early development of the heart. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2015]
OMIM 601667

Protein Summary

Protein general information Q15389  

Name: Angiopoietin 1 (ANG 1)

Length: 498  Mass: 57,513

Sequence MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRDAPHVE
PDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVET
QVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTR
QTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRI
ELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFD
ACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Structural information
Protein Domains
Fibrinogen (277-497)
Interpro:  IPR028843 IPR014716 IPR014715 IPR002181 IPR020837
Prosite:   PS00514 PS51406

Pfam:  
PF00147
CDD:   cd00087

PDB:  
4EPU 4JYO 4K0V
PDBsum:   4EPU 4JYO 4K0V
STRING:   ENSP00000428340;
Other Databases GeneCards:  ANGPT1;  Malacards:  ANGPT1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000165 MAPK cascade
TAS biological_process
GO:0001701 in utero embryonic develo
pment
IEA biological_process
GO:0001933 negative regulation of pr
otein phosphorylation
IEA biological_process
GO:0002040 sprouting angiogenesis
IDA biological_process
GO:0002040 sprouting angiogenesis
IDA biological_process
GO:0002092 positive regulation of re
ceptor internalization
IDA biological_process
GO:0002740 negative regulation of cy
tokine secretion involved
in immune response
IEA biological_process
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005622 intracellular
IEA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005902 microvillus
IDA cellular_component
GO:0007162 negative regulation of ce
ll adhesion
IDA biological_process
GO:0007171 activation of transmembra
ne receptor protein tyros
ine kinase activity
IDA biological_process
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IEA biological_process
GO:0014842 regulation of skeletal mu
scle satellite cell proli
feration
IDA biological_process
GO:0030097 hemopoiesis
IEA biological_process
GO:0030154 cell differentiation
IEA biological_process
GO:0030210 heparin biosynthetic proc
ess
IDA biological_process
GO:0030971 receptor tyrosine kinase
binding
IPI molecular_function
GO:0030971 receptor tyrosine kinase
binding
IPI molecular_function
GO:0031398 positive regulation of pr
otein ubiquitination
IDA biological_process
GO:0031589 cell-substrate adhesion
IEA biological_process
GO:0032680 regulation of tumor necro
sis factor production
IEA biological_process
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
IEA biological_process
GO:0034394 protein localization to c
ell surface
IDA biological_process
GO:0042308 negative regulation of pr
otein import into nucleus
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043116 negative regulation of va
scular permeability
IDA biological_process
GO:0043116 negative regulation of va
scular permeability
IDA biological_process
GO:0043122 regulation of I-kappaB ki
nase/NF-kappaB signaling
IEA biological_process
GO:0043393 regulation of protein bin
ding
IEA biological_process
GO:0043524 negative regulation of ne
uron apoptotic process
IEA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043547 positive regulation of GT
Pase activity
IEA biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0045785 positive regulation of ce
ll adhesion
IEA biological_process
GO:0048014 Tie signaling pathway
IDA biological_process
GO:0048014 Tie signaling pathway
IDA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0050900 leukocyte migration
TAS biological_process
GO:0050918 positive chemotaxis
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:0072012 glomerulus vasculature de
velopment
ISS biological_process
GO:2000352 negative regulation of en
dothelial cell apoptotic
process
IDA biological_process
GO:2000446 regulation of macrophage
migration inhibitory fact
or signaling pathway
IEA biological_process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological_process
GO:0000165 MAPK cascade
TAS biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001701 in utero embryonic develo
pment
IEA biological_process
GO:0001933 negative regulation of pr
otein phosphorylation
IEA biological_process
GO:0002040 sprouting angiogenesis
IDA biological_process
GO:0002040 sprouting angiogenesis
IDA biological_process
GO:0002092 positive regulation of re
ceptor internalization
IDA biological_process
GO:0002740 negative regulation of cy
tokine secretion involved
in immune response
IEA biological_process
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular_function
GO:0005102 receptor binding
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005622 intracellular
IEA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005902 microvillus
IDA cellular_component
GO:0007162 negative regulation of ce
ll adhesion
IDA biological_process
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
IEA biological_process
GO:0007171 activation of transmembra
ne receptor protein tyros
ine kinase activity
IDA biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IEA biological_process
GO:0014842 regulation of skeletal mu
scle satellite cell proli
feration
IDA biological_process
GO:0030097 hemopoiesis
IEA biological_process
GO:0030154 cell differentiation
IEA biological_process
GO:0030210 heparin biosynthetic proc
ess
IDA biological_process
GO:0030971 receptor tyrosine kinase
binding
IEA molecular_function
GO:0030971 receptor tyrosine kinase
binding
IPI molecular_function
GO:0030971 receptor tyrosine kinase
binding
IPI molecular_function
GO:0031398 positive regulation of pr
otein ubiquitination
IDA biological_process
GO:0031589 cell-substrate adhesion
IEA biological_process
GO:0032680 regulation of tumor necro
sis factor production
IEA biological_process
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
IEA biological_process
GO:0034394 protein localization to c
ell surface
IDA biological_process
GO:0042308 negative regulation of pr
otein import into nucleus
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043116 negative regulation of va
scular permeability
IEA biological_process
GO:0043116 negative regulation of va
scular permeability
IDA biological_process
GO:0043116 negative regulation of va
scular permeability
IDA biological_process
GO:0043122 regulation of I-kappaB ki
nase/NF-kappaB signaling
IEA biological_process
GO:0043393 regulation of protein bin
ding
IEA biological_process
GO:0043524 negative regulation of ne
uron apoptotic process
IEA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043547 positive regulation of GT
Pase activity
IEA biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0045785 positive regulation of ce
ll adhesion
IEA biological_process
GO:0048014 Tie signaling pathway
IEA biological_process
GO:0048014 Tie signaling pathway
IDA biological_process
GO:0048014 Tie signaling pathway
IDA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IEA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0050900 leukocyte migration
TAS biological_process
GO:0050918 positive chemotaxis
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:0072012 glomerulus vasculature de
velopment
IEA biological_process
GO:0072012 glomerulus vasculature de
velopment
ISS biological_process
GO:2000352 negative regulation of en
dothelial cell apoptotic
process
IDA biological_process
GO:2000446 regulation of macrophage
migration inhibitory fact
or signaling pathway
IEA biological_process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological_process
GO:0000165 MAPK cascade
TAS biological_process
GO:0002040 sprouting angiogenesis
IDA biological_process
GO:0002040 sprouting angiogenesis
IDA biological_process
GO:0002092 positive regulation of re
ceptor internalization
IDA biological_process
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005902 microvillus
IDA cellular_component
GO:0007162 negative regulation of ce
ll adhesion
IDA biological_process
GO:0007171 activation of transmembra
ne receptor protein tyros
ine kinase activity
IDA biological_process
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0014842 regulation of skeletal mu
scle satellite cell proli
feration
IDA biological_process
GO:0030210 heparin biosynthetic proc
ess
IDA biological_process
GO:0030971 receptor tyrosine kinase
binding
IPI molecular_function
GO:0030971 receptor tyrosine kinase
binding
IPI molecular_function
GO:0031398 positive regulation of pr
otein ubiquitination
IDA biological_process
GO:0034394 protein localization to c
ell surface
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043116 negative regulation of va
scular permeability
IDA biological_process
GO:0043116 negative regulation of va
scular permeability
IDA biological_process
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0048014 Tie signaling pathway
IDA biological_process
GO:0048014 Tie signaling pathway
IDA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0050900 leukocyte migration
TAS biological_process
GO:0050918 positive chemotaxis
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological_process
GO:0072012 glomerulus vasculature de
velopment
ISS biological_process
GO:2000352 negative regulation of en
dothelial cell apoptotic
process
IDA biological_process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05323  Rheumatoid arthritis

Diseases

Associated diseases References
Endometriosis PMID: 16723371
Female infertility PMID: 18644593
Ovarian hyperstimulation syndrome (OHSS) PMID: 25485810
Polycystic ovary syndrome (PCOS) PMID: 24889290
Endometriosis INFBASE15019822

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
16723371 Endometrio
sis

120 (56 women w
ith severe endo
metriosis, 64 w
omen without en
dometriosis)
Ang-1
Ang-2
Tie-2
Show abstract
18644593 Endometrio
sis

60 (30 women wi
th endometriosi
s, 30 endometri
um biopsy sampl
es from 30 heal
thy women)
ANGPT1
ANGPT2
MMP-1
MMP-2
MMP-9
VEGF
Show abstract
15019822 Endometrio
sis


ANGPT1
ANGPT2
Show abstract