Endometriosis Knowledgebase

Search Result

Gene id

285

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ANGPT2 Gene UCSC Ensembl

Aliases

AGPT2, ANG2

Gene name

angiopoietin 2

Alternate names

angiopoietin-2, ANG-2, Tie2-ligand, angiopoietin-2B, angiopoietin-2a,

Gene location

8p23.1 (6563419: 6499650) Exons: 9 NC_000008.11

Gene summary(Entrez)

The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

601922

Protein Summary

Protein general information

O15123

Name: Angiopoietin 2 (ANG 2)

Length: 496 Mass: 56,919

Sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDD
SVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVL
NQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNS
IIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHL
KDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDAC
GPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Structural information

Protein Domains	Fibrinogen (275-495)
Interpro:	IPR028844 IPR014716 IPR014715 IPR002181 IPR020837
Prosite:	PS00514 PS51406
Pfam:	PF00147
CDD:	cd00087
PDB:	1Z3S 1Z3U 2GY7 4JZC 4ZFG
PDBsum:	1Z3S 1Z3U 2GY7 4JZC 4ZFG
DIP:	6048
MINT:	8247351
STRING:	ENSP00000314897;

Other Databases

GeneCards: ANGPT2; Malacards: ANGPT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0009314	response to radiation	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0016525	negative regulation of an giogenesis	IEA	biological_process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050928	negative regulation of po sitive chemotaxis	IDA	biological_process
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0072012	glomerulus vasculature de velopment	ISS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0009314	response to radiation	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0016525	negative regulation of an giogenesis	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular_function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0048514	blood vessel morphogenesi s	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050928	negative regulation of po sitive chemotaxis	IDA	biological_process
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0072012	glomerulus vasculature de velopment	IEA	biological_process
GO:0072012	glomerulus vasculature de velopment	ISS	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular_function
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050928	negative regulation of po sitive chemotaxis	IDA	biological_process
GO:0072012	glomerulus vasculature de velopment	ISS	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04066  HIF-1 signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 16723371
Lymphedema	PMID: 18564921
Recurrent miscarriage	PMID: 14556828
Respiratory distress syndrome	PMID: 19271210
Retinopathy	PMID: 16877277
Stroke	PMID: 19341361
Endometriosis	INFBASE16723371
Uterine leiomyomas	PMID: 16009172

PubMed references

PMID	Condition	Ethnicity	Population details	Associated_genes	Abstract
16723371	Endometrio sis		120 (56 women w ith severe endo metriosis, 64 w omen without en dometriosis)	Ang-1 Ang-2 Tie-2	Show abstract
16762179	Endometrio sis	235	Hpa (108 (53 ec topic endometri um and 47 eutop ic endometrium specimens in th e EM group, 8 n ormal endometri um specimens in the control gr oup), Ang-2 (12 7 (61 ectopic e ndometrium, 56 eutopic endomet rium specimens in the EM group ,10 normal endo metrium specime	Hpa Ang-2	Show abstract
17141400	Endometrio sis		116 (86 ectopic and eutopic en dometrium of pa tients undergoi ng laparoscopy for endometrios is, 30 normal e ndometrium of p atients undergo ing laparoscopi c tubal ligatio n or hysterosco pic resection b ecause of uteru s septus)	Hpa Ang-2	Show abstract
18644593	Endometrio sis		60 (30 women wi th endometriosi s, 30 endometri um biopsy sampl es from 30 heal thy women)	ANGPT1 ANGPT2 MMP-1 MMP-2 MMP-9 VEGF	Show abstract
15019822	Endometrio sis			ANGPT1 ANGPT2	Show abstract