Endometriosis Knowledgebase

Search Result

Gene id

2852

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

GPER1 Gene UCSC Ensembl

Aliases

CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR, mER

Gene name

G protein-coupled estrogen receptor 1

Alternate names

G-protein coupled estrogen receptor 1, G protein-coupled receptor 30, IL8-related receptor DRY12, chemoattractant receptor-like 2, chemokine receptor-like 2, constitutively expressed peptide-like receptor, flow-induced endothelial G-protein coupled receptor 1, h,

Gene location

7p22.3 (1086806: 1093814) Exons: 3 NC_000007.14

Gene summary(Entrez)

This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq, Jul 2008]

OMIM

601805

Protein Summary

Protein general information

Q99527

Name: G protein coupled estrogen receptor 1 (Chemoattractant receptor like 2) (Flow induced endothelial G protein coupled receptor 1) (FEG 1) (G protein coupled estrogen receptor 1) (G protein coupled receptor 30) (GPCR Br) (IL8 related receptor DRY12) (Lymphoc

Length: 375 Mass: 42,248

Tissue specificity: Expressed in placenta, endothelial and epithelial cells, non laboring and laboring term myometrium, fibroblasts and cancer-associated fibroblasts (CAF), prostate cancer cells and invasive adenocarcinoma (at protein level). Ubiquitously

Sequence

MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFV
GNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTW
MSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIV
PFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV

Structural information

Interpro:	IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000297469;

Other Databases

GeneCards: GPER1; Malacards: GPER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0001934	positive regulation of pr otein phosphorylation	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001956	positive regulation of ne urotransmitter secretion	ISS	biological_process
GO:0002695	negative regulation of le ukocyte activation	IDA	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0005496	steroid binding	IDA	molecular_function
GO:0005496	steroid binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0008144	drug binding	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	ISS	biological_process
GO:0010579	positive regulation of ad enylate cyclase activity involved in G-protein cou pled receptor signaling p athway	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010948	negative regulation of ce ll cycle process	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014069	postsynaptic density	ISS	cellular_component
GO:0017082	mineralocorticoid recepto r activity	ISS	molecular_function
GO:0019228	neuronal action potential	ISS	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0030263	apoptotic chromosome cond ensation	ISS	biological_process
GO:0030264	nuclear fragmentation inv olved in apoptotic nuclea r change	ISS	biological_process
GO:0030284	estrogen receptor activit y	IDA	molecular_function
GO:0030284	estrogen receptor activit y	IDA	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0030518	intracellular steroid hor mone receptor signaling p athway	IDA	biological_process
GO:0030659	cytoplasmic vesicle membr ane	IDA	cellular_component
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031959	mineralocorticoid recepto r signaling pathway	IEA	biological_process
GO:0031966	mitochondrial membrane	ISS	cellular_component
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0032591	dendritic spine membrane	ISS	cellular_component
GO:0032962	positive regulation of in ositol trisphosphate bios ynthetic process	IDA	biological_process
GO:0042734	presynaptic membrane	ISS	cellular_component
GO:0043065	positive regulation of ap optotic process	ISS	biological_process
GO:0043198	dendritic shaft	ISS	cellular_component
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	ISS	biological_process
GO:0043401	steroid hormone mediated signaling pathway	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	ISS	biological_process
GO:0043679	axon terminus	ISS	cellular_component
GO:0044327	dendritic spine head	ISS	cellular_component
GO:0045087	innate immune response	IEA	biological_process
GO:0045095	keratin filament	IDA	cellular_component
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IDA	biological_process
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045909	positive regulation of va sodilation	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048786	presynaptic active zone	ISS	cellular_component
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050769	positive regulation of ne urogenesis	ISS	biological_process
GO:0051053	negative regulation of DN A metabolic process	ISS	biological_process
GO:0051055	negative regulation of li pid biosynthetic process	ISS	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051480	regulation of cytosolic c alcium ion concentration	ISS	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IMP	biological_process
GO:0055037	recycling endosome	IDA	cellular_component
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070474	positive regulation of ut erine smooth muscle contr action	IDA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	ISS	biological_process
GO:0071333	cellular response to gluc ose stimulus	ISS	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IDA	biological_process
GO:0071389	cellular response to mine ralocorticoid stimulus	ISS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:1904706	negative regulation of va scular smooth muscle cell proliferation	IMP	biological_process
GO:1990239	steroid hormone binding	IDA	molecular_function
GO:2000353	positive regulation of en dothelial cell apoptotic process	ISS	biological_process
GO:2000724	positive regulation of ca rdiac vascular smooth mus cle cell differentiation	IMP	biological_process
GO:2001238	positive regulation of ex trinsic apoptotic signali ng pathway	ISS	biological_process
GO:0005886	plasma membrane	IDA	cellular_component
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001956	positive regulation of ne urotransmitter secretion	ISS	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002695	negative regulation of le ukocyte activation	IDA	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005496	steroid binding	IDA	molecular_function
GO:0005496	steroid binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005622	intracellular	ISS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0008144	drug binding	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	ISS	biological_process
GO:0010579	positive regulation of ad enylate cyclase activity involved in G-protein cou pled receptor signaling p athway	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010948	negative regulation of ce ll cycle process	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014069	postsynaptic density	ISS	cellular_component
GO:0014069	postsynaptic density	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0017082	mineralocorticoid recepto r activity	ISS	molecular_function
GO:0019228	neuronal action potential	ISS	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0030154	cell differentiation	IEA	biological_process
GO:0030263	apoptotic chromosome cond ensation	ISS	biological_process
GO:0030264	nuclear fragmentation inv olved in apoptotic nuclea r change	ISS	biological_process
GO:0030284	estrogen receptor activit y	IEA	molecular_function
GO:0030284	estrogen receptor activit y	IDA	molecular_function
GO:0030284	estrogen receptor activit y	IDA	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030424	axon	IEA	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0030425	dendrite	IEA	cellular_component
GO:0030518	intracellular steroid hor mone receptor signaling p athway	IEA	biological_process
GO:0030518	intracellular steroid hor mone receptor signaling p athway	IDA	biological_process
GO:0030659	cytoplasmic vesicle membr ane	IEA	cellular_component
GO:0030659	cytoplasmic vesicle membr ane	IDA	cellular_component
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031959	mineralocorticoid recepto r signaling pathway	IEA	biological_process
GO:0031966	mitochondrial membrane	ISS	cellular_component
GO:0031966	mitochondrial membrane	IEA	cellular_component
GO:0032024	positive regulation of in sulin secretion	IEA	biological_process
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0032591	dendritic spine membrane	ISS	cellular_component
GO:0032962	positive regulation of in ositol trisphosphate bios ynthetic process	IDA	biological_process
GO:0042562	hormone binding	IEA	molecular_function
GO:0042734	presynaptic membrane	ISS	cellular_component
GO:0042995	cell projection	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	ISS	biological_process
GO:0043198	dendritic shaft	ISS	cellular_component
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	ISS	biological_process
GO:0043401	steroid hormone mediated signaling pathway	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	ISS	biological_process
GO:0043679	axon terminus	ISS	cellular_component
GO:0044327	dendritic spine head	ISS	cellular_component
GO:0045087	innate immune response	IEA	biological_process
GO:0045095	keratin filament	IDA	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IEA	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IDA	biological_process
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045909	positive regulation of va sodilation	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048786	presynaptic active zone	ISS	cellular_component
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050769	positive regulation of ne urogenesis	IEA	biological_process
GO:0050769	positive regulation of ne urogenesis	ISS	biological_process
GO:0051053	negative regulation of DN A metabolic process	ISS	biological_process
GO:0051055	negative regulation of li pid biosynthetic process	IEA	biological_process
GO:0051055	negative regulation of li pid biosynthetic process	ISS	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051480	regulation of cytosolic c alcium ion concentration	ISS	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IMP	biological_process
GO:0055037	recycling endosome	IEA	cellular_component
GO:0055037	recycling endosome	IDA	cellular_component
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070474	positive regulation of ut erine smooth muscle contr action	IDA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	IEA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	ISS	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	ISS	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IDA	biological_process
GO:0071389	cellular response to mine ralocorticoid stimulus	ISS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IEA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:1904706	negative regulation of va scular smooth muscle cell proliferation	IMP	biological_process
GO:1990239	steroid hormone binding	IDA	molecular_function
GO:2000353	positive regulation of en dothelial cell apoptotic process	ISS	biological_process
GO:2000724	positive regulation of ca rdiac vascular smooth mus cle cell differentiation	IMP	biological_process
GO:2001238	positive regulation of ex trinsic apoptotic signali ng pathway	ISS	biological_process
GO:0005886	plasma membrane	IDA	cellular_component
GO:0001934	positive regulation of pr otein phosphorylation	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001956	positive regulation of ne urotransmitter secretion	ISS	biological_process
GO:0002695	negative regulation of le ukocyte activation	IDA	biological_process
GO:0003682	chromatin binding	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005496	steroid binding	IDA	molecular_function
GO:0005496	steroid binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	ISS	biological_process
GO:0010579	positive regulation of ad enylate cyclase activity involved in G-protein cou pled receptor signaling p athway	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010948	negative regulation of ce ll cycle process	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014069	postsynaptic density	ISS	cellular_component
GO:0017082	mineralocorticoid recepto r activity	ISS	molecular_function
GO:0019228	neuronal action potential	ISS	biological_process
GO:0030263	apoptotic chromosome cond ensation	ISS	biological_process
GO:0030264	nuclear fragmentation inv olved in apoptotic nuclea r change	ISS	biological_process
GO:0030284	estrogen receptor activit y	IDA	molecular_function
GO:0030284	estrogen receptor activit y	IDA	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030425	dendrite	ISS	cellular_component
GO:0030518	intracellular steroid hor mone receptor signaling p athway	IDA	biological_process
GO:0030659	cytoplasmic vesicle membr ane	IDA	cellular_component
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031966	mitochondrial membrane	ISS	cellular_component
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0032591	dendritic spine membrane	ISS	cellular_component
GO:0032962	positive regulation of in ositol trisphosphate bios ynthetic process	IDA	biological_process
GO:0042734	presynaptic membrane	ISS	cellular_component
GO:0043065	positive regulation of ap optotic process	ISS	biological_process
GO:0043198	dendritic shaft	ISS	cellular_component
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	ISS	biological_process
GO:0043401	steroid hormone mediated signaling pathway	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	ISS	biological_process
GO:0043679	axon terminus	ISS	cellular_component
GO:0044327	dendritic spine head	ISS	cellular_component
GO:0045095	keratin filament	IDA	cellular_component
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045742	positive regulation of ep idermal growth factor rec eptor signaling pathway	IDA	biological_process
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045909	positive regulation of va sodilation	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048786	presynaptic active zone	ISS	cellular_component
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050769	positive regulation of ne urogenesis	ISS	biological_process
GO:0051053	negative regulation of DN A metabolic process	ISS	biological_process
GO:0051055	negative regulation of li pid biosynthetic process	ISS	biological_process
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051480	regulation of cytosolic c alcium ion concentration	ISS	biological_process
GO:0051898	negative regulation of pr otein kinase B signaling	IMP	biological_process
GO:0055037	recycling endosome	IDA	cellular_component
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070474	positive regulation of ut erine smooth muscle contr action	IDA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	ISS	biological_process
GO:0071333	cellular response to gluc ose stimulus	ISS	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IDA	biological_process
GO:0071389	cellular response to mine ralocorticoid stimulus	ISS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0090200	positive regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:1904706	negative regulation of va scular smooth muscle cell proliferation	IMP	biological_process
GO:1990239	steroid hormone binding	IDA	molecular_function
GO:2000353	positive regulation of en dothelial cell apoptotic process	ISS	biological_process
GO:2000724	positive regulation of ca rdiac vascular smooth mus cle cell differentiation	IMP	biological_process
GO:2001238	positive regulation of ex trinsic apoptotic signali ng pathway	ISS	biological_process
GO:0005886	plasma membrane	IDA	cellular_component

KEGG pathways

hsa01522 Endocrine resistance
hsa04915 Estrogen signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 22378861
Endometriosis	PMID: 23458722
Ovarian endometriosis	PMID: 26193952
Ovarian endometriosis	PMID: 22573494
Ovarian endometriosis	PMID: 26333495
Polycystic ovary syndrome (PCOS)	PMID: 26649621
Ovarian endometriosis	INFBASE26333495
Ovarian endometriosis	INFBASE26193952
Ovarian endometriosis	INFBASE22573494
Endometriosis	INFBASE22378861

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
22378861	Endometrio sis			GPER	Show abstract
22520060	Endometrio sis	104 (74 samples from different types of endom etriosis (27 ov arian, 19 perit oneal and 28 de ep-infiltrating ) and 30 sample s from normal e ndometrial tiss ue)			Show abstract
26193952	Endometrio sis (ovari an)	36 (21 patients with ovarian e ndometriosis (p aired ectopic a nd eutopic endo metrium) and 1 5 patients with normal endomet rium)			Show abstract
22573494	Endometrio sis (ovari an)	79 (ovarian end ometriosis, n = 26; ovarian pe lvic inflammato ry disease [PID ], n = 10; norm al ovaries/endo metrium, n = 30 /13)		GPER	Show abstract
26333495	Endometrio sis (ovari an)			GPER Gankyrin	Show abstract
23458722	Endometrio sis	38 (28 patients with endometri osis, 10 patien ts with leiomyo ma)	Female infertility	PTPN22 ACP1 and p53	Show abstract