Endometriosis Knowledgebase

Search Result

Gene id

2878

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

GPX3 Gene UCSC Ensembl

Aliases

GPx-P, GSHPx-3, GSHPx-P

Gene name

glutathione peroxidase 3

Alternate names

glutathione peroxidase 3, GPx-3, extracellular glutathione peroxidase, glutathione peroxidase 3 (plasma), plasma glutathione peroxidase,

Gene location

5q33.1 (151020437: 151028992) Exons: 5 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2016]

OMIM

138321

Protein Summary

Protein general information

P22352

Name: Glutathione peroxidase 3 (GPx 3) (GSHPx 3) (EC 1.11.1.9) (Extracellular glutathione peroxidase) (Plasma glutathione peroxidase) (GPx P) (GSHPx P)

Length: 226 Mass: 25,552

Tissue specificity: Secreted in plasma.

Sequence

MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGL
TGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYT
FLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKR
K

Structural information

Interpro:	IPR000889 IPR029759 IPR029760 IPR012336
Prosite:	PS00460 PS00763 PS51355
Pfam:	PF00255
CDD:	cd00340
PDB:	2R37
PDBsum:	2R37
STRING:	ENSP00000373477;

Other Databases

GeneCards: GPX3; Malacards: GPX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0004602	glutathione peroxidase ac tivity	IDA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006982	response to lipid hydrope roxide	TAS	biological_process
GO:0008134	transcription factor bind ing	TAS	molecular_function
GO:0008430	selenium binding	IDA	molecular_function
GO:0008430	selenium binding	IDA	molecular_function
GO:0042744	hydrogen peroxide catabol ic process	TAS	biological_process
GO:0051289	protein homotetramerizati on	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IEA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IEA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IDA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0006982	response to lipid hydrope roxide	TAS	biological_process
GO:0008134	transcription factor bind ing	TAS	molecular_function
GO:0008430	selenium binding	IDA	molecular_function
GO:0008430	selenium binding	IDA	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	TAS	biological_process
GO:0051289	protein homotetramerizati on	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0004602	glutathione peroxidase ac tivity	IDA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	EXP	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006982	response to lipid hydrope roxide	TAS	biological_process
GO:0008134	transcription factor bind ing	TAS	molecular_function
GO:0008430	selenium binding	IDA	molecular_function
GO:0008430	selenium binding	IDA	molecular_function
GO:0042744	hydrogen peroxide catabol ic process	TAS	biological_process
GO:0051289	protein homotetramerizati on	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa00590  Arachidonic acid metabolism
hsa04918  Thyroid hormone synthesis
hsa00480  Glutathione metabolism

Diseases

Associated diseases	References
Cancer	PMID: 19692168
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Diabetes	PMID: 12732844
Endometriosis	PMID: 25376627
Female infertility	PMID: 22999554
Ischemic heart disease	PMID: 17122425
Polycystic ovary syndrome (PCOS)	PMID: 24279306
Endometriosis	INFBASE25376627

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25376627	Endometrio sis			65 (31 patients with endometri osis, 34 patien ts without endo metriosis)	Female infertility	GPX3 IL6 IL8 TNF TXN TBPL2	Show abstract