Endometriosis Knowledgebase

Search Result

Gene id

2919

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCL1 Gene UCSC Ensembl

Aliases

FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1

Gene name

C-X-C motif chemokine ligand 1

Alternate names

growth-regulated alpha protein, C-X-C motif chemokine 1, GRO-alpha(1-73), GRO1 oncogene (melanoma growth stimulating activity, alpha), GRO1 oncogene (melanoma growth-stimulating activity), MGSA alpha, chemokine (C-X-C motif) ligand 1 (melanoma growth stimulatin,

Gene location

4q13.3 (73869391: 73871301) Exons: 4 NC_000004.12

Gene summary(Entrez)

This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]

OMIM

155730

Protein Summary

Protein general information

P09341

Name: Growth regulated alpha protein (C X C motif chemokine 1) (GRO alpha(1 73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil activating protein 3) (NAP 3) [Cleaved into: GRO alpha(4 73); GRO alpha(5 73); GRO alpha(6 73)]

Length: 107 Mass: 11,301

Sequence

MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVI
ATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Structural information

Interpro:	IPR001089 IPR018048 IPR001811 IPR033899
Prosite:	PS00471
Pfam:	PF00048
CDD:	cd00273
PDB:	1MGS 1MSG 1MSH 1ROD
PDBsum:	1MGS 1MSG 1MSH 1ROD
DIP:	5896
STRING:	ENSP00000379110;

Other Databases

GeneCards: CXCL1; Malacards: CXCL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008047	enzyme activator activity	TAS	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008047	enzyme activator activity	TAS	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008047	enzyme activator activity	TAS	molecular_function
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IBA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04657  IL-17 signaling pathway
hsa05323  Rheumatoid arthritis
hsa05146  Amoebiasis
hsa05134  Legionellosis
hsa05132  Salmonella infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
PTHR10179:SF69  CCKR signaling map
PTHR10179:SF69  CCKR signaling map

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 15843053
Endometrial cancer	PMID: 21912264
Endometriosis	PMID: 12012624
Female infertility	PMID: 22215622
Ovarian endometriosis	PMID: 15005245
Ovarian endometriosis	PMID: 15005245
Polycystic ovary syndrome (PCOS)	PMID: 24279306
Ovarian endometriosis	INFBASE15005245
Female infertility	INFBASE12012624
Endometriosis	INFBASE8942852

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
15005245	Endometrio sis (ovari an)			FCER1G PGDS IL-8 GRO1 GRO2 CXCR4 MCP1 MMP COL4A2 and COL5A2	Show abstract
12012624	Endometrio sis	22 women with a nd 21 without v isible endometr iotic lesions	Female infertility		Show abstract
8942852	Endometrio sis	82 (63 women wi th endometriosi s, 19 fertile w omen without en dometriosis)			Show abstract