Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 2920
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CXCL2   Gene   UCSC   Ensembl
Aliases CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
Gene name C-X-C motif chemokine ligand 2
Alternate names C-X-C motif chemokine 2, GRO2 oncogene, MGSA beta, MIP2-alpha, chemokine (C-X-C motif) ligand 2, gro-beta, growth-regulated protein beta, macrophage inflammatory protein 2-alpha, melanoma growth stimulatory activity beta,
Gene location 4q13.3 (74099279: 74097034)     Exons: 4     NC_000004.12
Gene summary(Entrez) This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]
OMIM 139110

Protein Summary

Protein general information P19875  

Name: C X C motif chemokine 2 (Growth regulated protein beta) (Gro beta) (Macrophage inflammatory protein 2 alpha) (MIP2 alpha) [Cleaved into: GRO beta(5 73) (GRO beta T) (Hematopoietic synergistic factor) (HSF) (SB 251353)]

Length: 107  Mass: 11,389

Sequence MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVI
ATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Structural information
Interpro:  IPR001089 IPR018048 IPR001811 IPR033899
Prosite:   PS00471

Pfam:  
PF00048
CDD:   cd00273

PDB:  
1QNK
PDBsum:   1QNK

DIP:  
5908
MINT:   6491498
STRING:   ENSP00000427279;
Other Databases GeneCards:  CXCL2;  Malacards:  CXCL2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0002237 response to molecule of b
acterial origin
IDA biological_process
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
IBA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IBA biological_process
GO:0008009 chemokine activity
IEA molecular_function
GO:0032496 response to lipopolysacch
aride
IBA biological_process
GO:0042127 regulation of cell prolif
eration
IBA biological_process
GO:0045236 CXCR chemokine receptor b
inding
IBA molecular_function
GO:0060326 cell chemotaxis
IEA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0090023 positive regulation of ne
utrophil chemotaxis
IBA biological_process
GO:0002237 response to molecule of b
acterial origin
IDA biological_process
GO:0005125 cytokine activity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006955 immune response
IEA biological_process
GO:0006955 immune response
IBA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IBA biological_process
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
TAS molecular_function
GO:0032496 response to lipopolysacch
aride
IBA biological_process
GO:0042127 regulation of cell prolif
eration
IBA biological_process
GO:0045236 CXCR chemokine receptor b
inding
IBA molecular_function
GO:0060326 cell chemotaxis
IEA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0090023 positive regulation of ne
utrophil chemotaxis
IBA biological_process
GO:0002237 response to molecule of b
acterial origin
IDA biological_process
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006955 immune response
IBA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IBA biological_process
GO:0008009 chemokine activity
TAS molecular_function
GO:0032496 response to lipopolysacch
aride
IBA biological_process
GO:0042127 regulation of cell prolif
eration
IBA biological_process
GO:0045236 CXCR chemokine receptor b
inding
IBA molecular_function
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0090023 positive regulation of ne
utrophil chemotaxis
IBA biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04657  IL-17 signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa05134  Legionellosis
hsa05132  Salmonella infection
PTHR10179:SF46  CCKR signaling map
PTHR10179:SF46  CCKR signaling map

Diseases

Associated diseases References
Endometriosis (ovarian) PMID: 15005245
Ovarian endometriosis PMID: 15005245
Polycystic ovary syndrome (PCOS) PMID: 24279306
Ovarian endometriosis INFBASE15005245

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
15005245 Endometrio
sis (ovari
an)


FCER1G
PGDS
IL-8
GRO1
GRO2
CXCR4
MCP1
MMP
COL4A2
and COL5A2
Show abstract