Endometriosis Knowledgebase

Search Result

Gene id

2932

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

GSK3B Gene UCSC Ensembl

Gene name

glycogen synthase kinase 3 beta

Alternate names

glycogen synthase kinase-3 beta, GSK-3 beta, GSK3beta isoform, serine/threonine-protein kinase GSK3B,

Gene location

3q13.33 (120094416: 119821320) Exons: 12 NC_000003.12

Gene summary(Entrez)

The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]

OMIM

605004

Protein Summary

Protein general information

P49841

Name: Glycogen synthase kinase 3 beta (GSK 3 beta) (EC 2.7.11.26) (Serine/threonine protein kinase GSK3B) (EC 2.7.11.1)

Length: 420 Mass: 46,744

Tissue specificity: Expressed in testis, thymus, prostate and ovary and weakly expressed in lung, brain and kidney. Colocalizes with EIF2AK2/PKR and TAU in the Alzheimer disease (AD) brain. {ECO

Sequence

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKL
CDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAK
QTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAP
ELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLAT
ILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Structural information

Protein Domains	Protein (56-340)
Interpro:	IPR033573 IPR011009 IPR000719 IPR017441 IPR008271
Prosite:	PS00107 PS50011 PS00108
Pfam:	PF00069
PDB:	1GNG 1H8F 1I09 1J1B 1J1C 1O6K 1O6L 1O9U 1PYX 1Q3D 1Q3W 1Q41 1Q4L 1Q5K 1R0E 1UV5 2JDO 2JDR 2JLD 2O5K 2OW3 2UW9 2X39 2XH5 3CQU 3CQW 3DU8 3E87 3E88 3E8D 3F7Z 3F88 3GB2 3I4B 3L1S 3M1S 3MV5 3OW4 3PUP 3Q3B 3QKK 3SAY 3SD0 3ZDI 3ZRK 3ZRL 3ZRM 4ACC 4ACD 4ACG 4ACH
PDBsum:	1GNG 1H8F 1I09 1J1B 1J1C 1O6K 1O6L 1O9U 1PYX 1Q3D 1Q3W 1Q41 1Q4L 1Q5K 1R0E 1UV5 2JDO 2JDR 2JLD 2O5K 2OW3 2UW9 2X39 2XH5 3CQU 3CQW 3DU8 3E87 3E88 3E8D 3F7Z 3F88 3GB2 3I4B 3L1S 3M1S 3MV5 3OW4 3PUP 3Q3B 3QKK 3SAY 3SD0 3ZDI 3ZRK 3ZRL 3ZRM 4ACC 4ACD 4ACG 4ACH
DIP:	878
MINT:	105006
STRING:	ENSP00000324806;

Other Databases

GeneCards: GSK3B; Malacards: GSK3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000320	re-entry into mitotic cel l cycle	IEA	biological_process
GO:0001085	RNA polymerase II transcr iption factor binding	IPI	molecular_function
GO:0001837	epithelial to mesenchymal transition	IMP	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IMP	biological_process
GO:0002039	p53 binding	IDA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005977	glycogen metabolic proces s	IDA	biological_process
GO:0006349	regulation of gene expres sion by genetic imprintin g	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006611	protein export from nucle us	IEA	biological_process
GO:0006983	ER overload response	IDA	biological_process
GO:0007212	dopamine receptor signali ng pathway	NAS	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007520	myoblast fusion	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007623	circadian rhythm	ISS	biological_process
GO:0008013	beta-catenin binding	IPI	molecular_function
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0010614	negative regulation of ca rdiac muscle hypertrophy	IEA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IEA	biological_process
GO:0010918	positive regulation of mi tochondrial membrane pote ntial	IEA	biological_process
GO:0014043	negative regulation of ne uron maturation	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016477	cell migration	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0021766	hippocampus development	IMP	biological_process
GO:0030010	establishment of cell pol arity	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030426	growth cone	IEA	cellular_component
GO:0030529	intracellular ribonucleop rotein complex	IEA	cellular_component
GO:0030877	beta-catenin destruction complex	TAS	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	TAS	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0031333	negative regulation of pr otein complex assembly	IMP	biological_process
GO:0031334	positive regulation of pr otein complex assembly	IDA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032092	positive regulation of pr otein binding	ISS	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IC	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032886	regulation of microtubule -based process	IMP	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0034236	protein kinase A catalyti c subunit binding	IPI	molecular_function
GO:0034392	negative regulation of sm ooth muscle cell apoptoti c process	IEA	biological_process
GO:0035255	ionotropic glutamate rece ptor binding	IEA	molecular_function
GO:0035372	protein localization to m icrotubule	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0036016	cellular response to inte rleukin-3	ISS	biological_process
GO:0036018	cellular response to eryt hropoietin	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043198	dendritic shaft	IEA	cellular_component
GO:0043407	negative regulation of MA P kinase activity	IEA	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0044027	hypermethylation of CpG i sland	IEA	biological_process
GO:0044337	canonical Wnt signaling p athway involved in positi ve regulation of apoptoti c process	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0045719	negative regulation of gl ycogen biosynthetic proce ss	TAS	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IC	biological_process
GO:0045773	positive regulation of ax on extension	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046827	positive regulation of pr otein export from nucleus	IDA	biological_process
GO:0048156	tau protein binding	IEA	molecular_function
GO:0048168	regulation of neuronal sy naptic plasticity	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050321	tau-protein kinase activi ty	IDA	molecular_function
GO:0050321	tau-protein kinase activi ty	IDA	molecular_function
GO:0050774	negative regulation of de ndrite morphogenesis	IEA	biological_process
GO:0051001	negative regulation of ni tric-oxide synthase activ ity	IEA	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051534	negative regulation of NF AT protein import into nu cleus	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IC	biological_process
GO:0070059	intrinsic apoptotic signa ling pathway in response to endoplasmic reticulum stress	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0071109	superior temporal gyrus d evelopment	IMP	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071282	cellular response to iron (II) ion	IEA	biological_process
GO:0071285	cellular response to lith ium ion	IEA	biological_process
GO:0071871	response to epinephrine	IEA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IC	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	ISS	biological_process
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1900181	negative regulation of pr otein localization to nuc leus	ISS	biological_process
GO:1901030	positive regulation of mi tochondrial outer membran e permeabilization involv ed in apoptotic signaling pathway	ISS	biological_process
GO:1901216	positive regulation of ne uron death	IDA	biological_process
GO:1902065	response to L-glutamate	IEA	biological_process
GO:1903351	cellular response to dopa mine	IEA	biological_process
GO:1904339	negative regulation of do paminergic neuron differe ntiation	TAS	biological_process
GO:1904885	beta-catenin destruction complex assembly	TAS	biological_process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological_process
GO:1990418	response to insulin-like growth factor stimulus	IEA	biological_process
GO:1990478	response to ultrasound	IEA	biological_process
GO:1990776	response to angiotensin	IEA	biological_process
GO:1990909	Wnt signalosome	TAS	cellular_component
GO:2000077	negative regulation of ty pe B pancreatic cell deve lopment	TAS	biological_process
GO:2000463	positive regulation of ex citatory postsynaptic pot ential	IEA	biological_process
GO:2000466	negative regulation of gl ycogen (starch) synthase activity	TAS	biological_process
GO:2000573	positive regulation of DN A biosynthetic process	IEA	biological_process
GO:2000738	positive regulation of st em cell differentiation	IEA	biological_process
GO:2001223	negative regulation of ne uron migration	IEA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000320	re-entry into mitotic cel l cycle	IEA	biological_process
GO:0001085	RNA polymerase II transcr iption factor binding	IPI	molecular_function
GO:0001837	epithelial to mesenchymal transition	IMP	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IMP	biological_process
GO:0002039	p53 binding	IDA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0005977	glycogen metabolic proces s	IEA	biological_process
GO:0005977	glycogen metabolic proces s	IDA	biological_process
GO:0006349	regulation of gene expres sion by genetic imprintin g	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006611	protein export from nucle us	IEA	biological_process
GO:0006983	ER overload response	IEA	biological_process
GO:0006983	ER overload response	IDA	biological_process
GO:0007163	establishment or maintena nce of cell polarity	IEA	biological_process
GO:0007212	dopamine receptor signali ng pathway	NAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0007409	axonogenesis	IEA	biological_process
GO:0007520	myoblast fusion	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0007623	circadian rhythm	ISS	biological_process
GO:0008013	beta-catenin binding	IEA	molecular_function
GO:0008013	beta-catenin binding	IPI	molecular_function
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0009968	negative regulation of si gnal transduction	IEA	biological_process
GO:0010226	response to lithium ion	IEA	biological_process
GO:0010614	negative regulation of ca rdiac muscle hypertrophy	IEA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IEA	biological_process
GO:0010918	positive regulation of mi tochondrial membrane pote ntial	IEA	biological_process
GO:0010975	regulation of neuron proj ection development	IEA	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	IEA	biological_process
GO:0014043	negative regulation of ne uron maturation	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014902	myotube differentiation	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016310	phosphorylation	IEA	biological_process
GO:0016477	cell migration	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IDA	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0021766	hippocampus development	IMP	biological_process
GO:0030010	establishment of cell pol arity	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030425	dendrite	IEA	cellular_component
GO:0030426	growth cone	IEA	cellular_component
GO:0030516	regulation of axon extens ion	IEA	biological_process
GO:0030529	intracellular ribonucleop rotein complex	IEA	cellular_component
GO:0030877	beta-catenin destruction complex	IEA	cellular_component
GO:0030877	beta-catenin destruction complex	TAS	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	TAS	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0031333	negative regulation of pr otein complex assembly	IMP	biological_process
GO:0031334	positive regulation of pr otein complex assembly	IDA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032092	positive regulation of pr otein binding	IEA	biological_process
GO:0032092	positive regulation of pr otein binding	ISS	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IEA	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IC	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032886	regulation of microtubule -based process	IEA	biological_process
GO:0032886	regulation of microtubule -based process	IMP	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0034236	protein kinase A catalyti c subunit binding	IPI	molecular_function
GO:0034392	negative regulation of sm ooth muscle cell apoptoti c process	IEA	biological_process
GO:0035255	ionotropic glutamate rece ptor binding	IEA	molecular_function
GO:0035372	protein localization to m icrotubule	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0036016	cellular response to inte rleukin-3	IEA	biological_process
GO:0036016	cellular response to inte rleukin-3	ISS	biological_process
GO:0036018	cellular response to eryt hropoietin	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043198	dendritic shaft	IEA	cellular_component
GO:0043227	membrane-bounded organell e	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0043407	negative regulation of MA P kinase activity	IEA	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0044027	hypermethylation of CpG i sland	IEA	biological_process
GO:0044297	cell body	IEA	cellular_component
GO:0044337	canonical Wnt signaling p athway involved in positi ve regulation of apoptoti c process	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0045719	negative regulation of gl ycogen biosynthetic proce ss	TAS	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IEA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IC	biological_process
GO:0045773	positive regulation of ax on extension	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046827	positive regulation of pr otein export from nucleus	IDA	biological_process
GO:0048156	tau protein binding	IEA	molecular_function
GO:0048168	regulation of neuronal sy naptic plasticity	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048511	rhythmic process	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0048814	regulation of dendrite mo rphogenesis	IEA	biological_process
GO:0050321	tau-protein kinase activi ty	IEA	molecular_function
GO:0050321	tau-protein kinase activi ty	IEA	molecular_function
GO:0050321	tau-protein kinase activi ty	IDA	molecular_function
GO:0050321	tau-protein kinase activi ty	IDA	molecular_function
GO:0050770	regulation of axonogenesi s	IEA	biological_process
GO:0050774	negative regulation of de ndrite morphogenesis	IEA	biological_process
GO:0051001	negative regulation of ni tric-oxide synthase activ ity	IEA	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051534	negative regulation of NF AT protein import into nu cleus	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IC	biological_process
GO:0070059	intrinsic apoptotic signa ling pathway in response to endoplasmic reticulum stress	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0071109	superior temporal gyrus d evelopment	IMP	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071282	cellular response to iron (II) ion	IEA	biological_process
GO:0071285	cellular response to lith ium ion	IEA	biological_process
GO:0071871	response to epinephrine	IEA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IC	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	ISS	biological_process
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1900181	negative regulation of pr otein localization to nuc leus	ISS	biological_process
GO:1901030	positive regulation of mi tochondrial outer membran e permeabilization involv ed in apoptotic signaling pathway	IEA	biological_process
GO:1901030	positive regulation of mi tochondrial outer membran e permeabilization involv ed in apoptotic signaling pathway	ISS	biological_process
GO:1901216	positive regulation of ne uron death	IDA	biological_process
GO:1902065	response to L-glutamate	IEA	biological_process
GO:1903351	cellular response to dopa mine	IEA	biological_process
GO:1904339	negative regulation of do paminergic neuron differe ntiation	IEA	biological_process
GO:1904339	negative regulation of do paminergic neuron differe ntiation	TAS	biological_process
GO:1904885	beta-catenin destruction complex assembly	TAS	biological_process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological_process
GO:1990418	response to insulin-like growth factor stimulus	IEA	biological_process
GO:1990478	response to ultrasound	IEA	biological_process
GO:1990776	response to angiotensin	IEA	biological_process
GO:1990909	Wnt signalosome	IEA	cellular_component
GO:1990909	Wnt signalosome	TAS	cellular_component
GO:2000077	negative regulation of ty pe B pancreatic cell deve lopment	TAS	biological_process
GO:2000171	negative regulation of de ndrite development	IEA	biological_process
GO:2000463	positive regulation of ex citatory postsynaptic pot ential	IEA	biological_process
GO:2000466	negative regulation of gl ycogen (starch) synthase activity	TAS	biological_process
GO:2000573	positive regulation of DN A biosynthetic process	IEA	biological_process
GO:2000738	positive regulation of st em cell differentiation	IEA	biological_process
GO:2001223	negative regulation of ne uron migration	IEA	biological_process
GO:0001085	RNA polymerase II transcr iption factor binding	IPI	molecular_function
GO:0001837	epithelial to mesenchymal transition	IMP	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IMP	biological_process
GO:0002039	p53 binding	IDA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005977	glycogen metabolic proces s	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006983	ER overload response	IDA	biological_process
GO:0007212	dopamine receptor signali ng pathway	NAS	biological_process
GO:0007623	circadian rhythm	ISS	biological_process
GO:0008013	beta-catenin binding	IPI	molecular_function
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	IDA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IDA	biological_process
GO:0018107	peptidyl-threonine phosph orylation	IDA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0021766	hippocampus development	IMP	biological_process
GO:0030877	beta-catenin destruction complex	TAS	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	TAS	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0030877	beta-catenin destruction complex	IDA	cellular_component
GO:0031333	negative regulation of pr otein complex assembly	IMP	biological_process
GO:0031334	positive regulation of pr otein complex assembly	IDA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032092	positive regulation of pr otein binding	ISS	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IC	biological_process
GO:0032886	regulation of microtubule -based process	IMP	biological_process
GO:0034236	protein kinase A catalyti c subunit binding	IPI	molecular_function
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0036016	cellular response to inte rleukin-3	ISS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	TAS	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0045719	negative regulation of gl ycogen biosynthetic proce ss	TAS	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IC	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046827	positive regulation of pr otein export from nucleus	IDA	biological_process
GO:0050321	tau-protein kinase activi ty	IDA	molecular_function
GO:0050321	tau-protein kinase activi ty	IDA	molecular_function
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0051534	negative regulation of NF AT protein import into nu cleus	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IC	biological_process
GO:0071109	superior temporal gyrus d evelopment	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IC	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	ISS	biological_process
GO:0099565	chemical synaptic transmi ssion, postsynaptic	NAS	biological_process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:1900181	negative regulation of pr otein localization to nuc leus	ISS	biological_process
GO:1901030	positive regulation of mi tochondrial outer membran e permeabilization involv ed in apoptotic signaling pathway	ISS	biological_process
GO:1901216	positive regulation of ne uron death	IDA	biological_process
GO:1904339	negative regulation of do paminergic neuron differe ntiation	TAS	biological_process
GO:1904885	beta-catenin destruction complex assembly	TAS	biological_process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological_process
GO:1990909	Wnt signalosome	TAS	cellular_component
GO:2000077	negative regulation of ty pe B pancreatic cell deve lopment	TAS	biological_process
GO:2000466	negative regulation of gl ycogen (starch) synthase activity	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05169  Epstein-Barr virus infection
hsa04062  Chemokine signaling pathway
hsa05224  Breast cancer
hsa05164  Influenza A
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05215  Prostate cancer
hsa05162  Measles
hsa04657  IL-17 signaling pathway
hsa04390  Hippo signaling pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04919  Thyroid hormone signaling pathway
hsa05160  Hepatitis C
hsa04722  Neurotrophin signaling pathway
hsa04360  Axon guidance
hsa04110  Cell cycle
hsa04660  T cell receptor signaling pathway
hsa04917  Prolactin signaling pathway
hsa05210  Colorectal cancer
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa04150  mTOR signaling pathway
hsa05010  Alzheimer's disease
hsa04931  Insulin resistance
hsa05213  Endometrial cancer
hsa04310  Wnt signaling pathway
hsa04916  Melanogenesis
hsa04662  B cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa05217  Basal cell carcinoma
hsa04340  Hedgehog signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 12452480
Bipolar disorder	PMID: 16289783
Cancer	PMID: 19657367
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Depression	PMID: 20015462
Endometriosis	PMID: 25194152
Parkinson's disease	PMID: 16315267
Polycystic ovary syndrome (PCOS)	PMID: 17270183
Polycystic ovary syndrome (PCOS)	PMID: 18178198
Endometriosis	INFBASE25194152
Schizophrenia	PMID: 15719395
Spermatogenetic defects	PMID: 26209830
Spermatogenetic defects	PMID: 26209830
Varicocele	PMID: 26209830

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25194152	Endometrio sis			60 (35 women wi th endometriosi s, 25 fertile e umenorrheic wom en)		Ki67 SCF Akt GSK3B	Show abstract